BLASTX nr result
ID: Papaver32_contig00033875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033875 (505 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDP41341.1 hypothetical protein JCGZ_15748 [Jatropha curcas] 54 6e-07 KJB46757.1 hypothetical protein B456_008G175600 [Gossypium raimo... 54 7e-07 >KDP41341.1 hypothetical protein JCGZ_15748 [Jatropha curcas] Length = 71 Score = 54.3 bits (129), Expect = 6e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 222 RKTMKAPGKDERMYRDNFEKDPASYFRSER 311 RKTMKAPGKD R++RD FEKDPA+YFR+ R Sbjct: 40 RKTMKAPGKDGRIFRDEFEKDPAAYFRNNR 69 >KJB46757.1 hypothetical protein B456_008G175600 [Gossypium raimondii] Length = 69 Score = 53.9 bits (128), Expect = 7e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 222 RKTMKAPGKDERMYRDNFEKDPASYFRSERK 314 RKTMKAPG++ R+YRD+FE+DPASYFR+ RK Sbjct: 39 RKTMKAPGRNYRIYRDDFERDPASYFRNLRK 69