BLASTX nr result
ID: Papaver32_contig00033873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033873 (526 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB46757.1 hypothetical protein B456_008G175600 [Gossypium raimo... 60 5e-09 >KJB46757.1 hypothetical protein B456_008G175600 [Gossypium raimondii] Length = 69 Score = 59.7 bits (143), Expect = 5e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 159 NRKTMKAPGKNERMYRDNFEKDTASYFRNLRK 254 NRKTMKAPG+N R+YRD+FE+D ASYFRNLRK Sbjct: 38 NRKTMKAPGRNYRIYRDDFERDPASYFRNLRK 69