BLASTX nr result
ID: Papaver32_contig00033753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033753 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010262277.1 PREDICTED: sn1-specific diacylglycerol lipase bet... 62 3e-08 >XP_010262277.1 PREDICTED: sn1-specific diacylglycerol lipase beta [Nelumbo nucifera] Length = 553 Score = 61.6 bits (148), Expect = 3e-08 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = +3 Query: 264 MVKQSIRSFFLHIEYNANLQKKQEPYRQFVYSLLTQSRSQCSKADKPQCNGSKEAKDASQ 443 M QS++ FF H+ ++ N+ KKQE Y++F Y +L + +SQ S+ DK + +GS+E KD S+ Sbjct: 1 MANQSMKRFFHHLGFSINMLKKQESYKRFAYKVLVRCQSQSSETDKAETDGSREGKDVSR 60