BLASTX nr result
ID: Papaver32_contig00033499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033499 (513 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003850653.1 40S ribosomal protein S28 [Zymoseptoria tritici I... 112 1e-29 XP_008085508.1 Nucleic acid-binding protein [Glarea lozoyensis A... 111 4e-29 XP_007681584.1 hypothetical protein BAUCODRAFT_315059 [Baudoinia... 110 5e-29 APA07219.1 hypothetical protein sscle_02g019890 [Sclerotinia scl... 112 6e-29 EMR82428.1 putative 40s ribosomal protein s28 protein [Botrytis ... 112 7e-29 XP_020131267.1 40s ribosomal protein s28 [Diplodia corticola] XP... 110 7e-29 KXS96058.1 hypothetical protein AC579_6355 [Pseudocercospora musae] 114 1e-28 XP_002153086.1 40S ribosomal protein S28 [Talaromyces marneffei ... 110 1e-28 ESZ95319.1 40S ribosomal protein S28 [Sclerotinia borealis F-412... 110 1e-28 XP_012743726.1 40S ribosomal protein S28 [Pseudogymnoascus destr... 110 1e-28 KXL43713.1 hypothetical protein FE78DRAFT_92371, partial [Acidom... 109 1e-28 CZR51008.1 40S ribosomal protein S28 [Phialocephala subalpina] 109 1e-28 KYG50465.1 hypothetical protein M433DRAFT_148900 [Acidomyces ric... 109 1e-28 CZT08461.1 related to 40S ribosomal protein S28 [Rhynchosporium ... 111 2e-28 OCK76572.1 ribosomal protein S28e, partial [Lepidopterella palus... 109 2e-28 OCL01585.1 ribosomal protein S28e [Glonium stellatum] 109 2e-28 XP_003009124.1 40S ribosomal protein S28 [Verticillium alfalfae ... 108 3e-28 XP_007779255.1 40S ribosomal protein S28 [Coniosporium apollinis... 108 3e-28 XP_007582595.1 putative 40s ribosomal protein s28 protein [Neofu... 108 3e-28 XP_001561242.1 40S ribosomal protein S28 [Botrytis cinerea B05.1... 108 4e-28 >XP_003850653.1 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] XP_007928825.1 hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] EGP85629.1 hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] EME79952.1 hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] GAM89234.1 hypothetical protein ANO11243_072710 [fungal sp. No.11243] KJX97506.1 40s ribosomal protein s28 [Zymoseptoria brevis] KXS95992.1 hypothetical protein AC578_8101 [Mycosphaerella eumusae] Length = 68 Score = 112 bits (280), Expect = 1e-29 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >XP_008085508.1 Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] EPE28149.1 Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] KIM97619.1 hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 111 bits (277), Expect = 4e-29 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >XP_007681584.1 hypothetical protein BAUCODRAFT_315059 [Baudoinia panamericana UAMH 10762] XP_013430056.1 ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] XP_018192365.1 ribosomal protein S28e [Xylona heveae TC161] EMC91116.1 hypothetical protein BAUCODRAFT_315059 [Baudoinia panamericana UAMH 10762] KEQ60881.1 ribosomal protein S28e [Aureobasidium melanogenum CBS 110374] KEQ76087.1 ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] KEQ85002.1 ribosomal protein S28e [Aureobasidium pullulans EXF-150] KZF26810.1 ribosomal protein S28e [Xylona heveae TC161] Length = 68 Score = 110 bits (276), Expect = 5e-29 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >APA07219.1 hypothetical protein sscle_02g019890 [Sclerotinia sclerotiorum 1980 UF-70] Length = 111 Score = 112 bits (279), Expect = 6e-29 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = +3 Query: 84 KMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 KMD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 43 KMDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 99 >EMR82428.1 putative 40s ribosomal protein s28 protein [Botrytis cinerea BcDW1] Length = 114 Score = 112 bits (279), Expect = 7e-29 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = +3 Query: 81 AKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 AKM+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 45 AKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 102 >XP_020131267.1 40s ribosomal protein s28 [Diplodia corticola] XP_020128951.1 40s ribosomal protein s28 [Diplodia corticola] EKG14828.1 Ribosomal protein S28e [Macrophomina phaseolina MS6] EKG17607.1 Histone core [Macrophomina phaseolina MS6] KKY19538.1 putative 40s ribosomal protein s28 [Diplodia seriata] KKY20058.1 putative 40s ribosomal protein s28 [Diplodia seriata] OJD32691.1 40s ribosomal protein s28 [Diplodia corticola] OJD35007.1 40s ribosomal protein s28 [Diplodia corticola] OMP81426.1 40S ribosomal protein S28 [Diplodia seriata] OMP84080.1 40S ribosomal protein S28 [Diplodia seriata] Length = 68 Score = 110 bits (275), Expect = 7e-29 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >KXS96058.1 hypothetical protein AC579_6355 [Pseudocercospora musae] Length = 189 Score = 114 bits (284), Expect = 1e-28 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = +3 Query: 81 AKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 A MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 120 ANMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 177 >XP_002153086.1 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] XP_002487548.1 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] XP_002487549.1 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] XP_020118751.1 40S ribosomal protein S28 [Talaromyces atroroseus] EEA18701.1 Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] EED13437.1 Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] EED13438.1 Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] KFX52824.1 40S ribosomal protein S28 [Talaromyces marneffei PM1] GAM43411.1 ribosomal protein [Talaromyces cellulolyticus] CRG91631.1 hypothetical protein PISL3812_08681 [Talaromyces islandicus] KUL86410.1 hypothetical protein ZTR_08157 [Talaromyces verruculosus] OKL58630.1 40S ribosomal protein S28 [Talaromyces atroroseus] Length = 68 Score = 110 bits (274), Expect = 1e-28 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >ESZ95319.1 40S ribosomal protein S28 [Sclerotinia borealis F-4128] CZT49878.1 40S ribosomal protein S28 [Rhynchosporium secalis] CZS98317.1 40S ribosomal protein S28 [Rhynchosporium agropyri] Length = 68 Score = 110 bits (274), Expect = 1e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >XP_012743726.1 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] XP_018132478.1 40S ribosomal protein S28 [Pseudogymnoascus verrucosus] ELR02139.1 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] OAF56822.1 40S ribosomal protein S28 [Pseudogymnoascus destructans] OBT48698.1 40S ribosomal protein S28 [Pseudogymnoascus sp. WSF 3629] OBT58853.1 40S ribosomal protein S28 [Pseudogymnoascus sp. 24MN13] OBT70031.1 40S ribosomal protein S28 [Pseudogymnoascus sp. 23342-1-I1] OBT77877.1 40S ribosomal protein S28 [Pseudogymnoascus sp. 05NY08] OBT88001.1 40S ribosomal protein S28 [Pseudogymnoascus sp. 03VT05] OBT98745.1 40S ribosomal protein S28 [Pseudogymnoascus verrucosus] Length = 68 Score = 110 bits (274), Expect = 1e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >KXL43713.1 hypothetical protein FE78DRAFT_92371, partial [Acidomyces richmondensis] Length = 67 Score = 109 bits (273), Expect = 1e-28 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >CZR51008.1 40S ribosomal protein S28 [Phialocephala subalpina] Length = 68 Score = 109 bits (273), Expect = 1e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MESSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >KYG50465.1 hypothetical protein M433DRAFT_148900 [Acidomyces richmondensis BFW] Length = 68 Score = 109 bits (273), Expect = 1e-28 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDS+K PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56 >CZT08461.1 related to 40S ribosomal protein S28 [Rhynchosporium commune] Length = 131 Score = 111 bits (278), Expect = 2e-28 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = +3 Query: 81 AKMDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 A MD++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 62 ANMDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 119 >OCK76572.1 ribosomal protein S28e, partial [Lepidopterella palustris CBS 459.81] Length = 67 Score = 109 bits (272), Expect = 2e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MD+AKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDAAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >OCL01585.1 ribosomal protein S28e [Glonium stellatum] Length = 68 Score = 109 bits (272), Expect = 2e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MD+AKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDAAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >XP_003009124.1 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] XP_009650088.1 hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] EEY14698.1 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] EGY13734.1 hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] CRK36463.1 hypothetical protein BN1708_007062 [Verticillium longisporum] CRK15241.1 hypothetical protein BN1708_011409 [Verticillium longisporum] CRK11466.1 hypothetical protein BN1723_001798 [Verticillium longisporum] Length = 68 Score = 108 bits (271), Expect = 3e-28 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >XP_007779255.1 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] EON63938.1 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 108 bits (271), Expect = 3e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 MDSAKVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >XP_007582595.1 putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] XP_007584949.1 putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] EOD47615.1 putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] EOD49893.1 putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 108 bits (271), Expect = 3e-28 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 M+SAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >XP_001561242.1 40S ribosomal protein S28 [Botrytis cinerea B05.10] CCD45669.1 hypothetical protein BofuT4P34000010001 [Botrytis cinerea T4] Length = 68 Score = 108 bits (270), Expect = 4e-28 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = +3 Query: 87 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 254 M+++KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDILC 56