BLASTX nr result
ID: Papaver32_contig00033399
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033399 (472 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018381678.1 ribosomal protein S28e [Alternaria alternata] OAG... 114 1e-30 XP_001938519.1 40S ribosomal protein S28 [Pyrenophora tritici-re... 110 5e-29 XP_001798512.1 hypothetical protein SNOG_08190 [Parastagonospora... 109 1e-28 XP_015402063.1 40S ribosomal protein S28, partial [Aspergillus n... 108 5e-28 KZL81386.1 40s ribosomal protein s28, partial [Colletotrichum in... 108 5e-28 KZM27071.1 structural constituent of ribosome [Ascochyta rabiei] 106 2e-27 XP_018030669.1 ribosomal protein S28e [Paraphaeosphaeria sporulo... 105 4e-27 KUI56796.1 40S ribosomal protein S28 [Valsa mali var. pyri] KUI7... 103 2e-26 XP_007915668.1 putative 40s ribosomal protein s28 protein [Phaeo... 103 2e-26 XP_002153086.1 40S ribosomal protein S28 [Talaromyces marneffei ... 103 4e-26 XP_020131267.1 40s ribosomal protein s28 [Diplodia corticola] XP... 102 5e-26 XP_007827699.1 40S ribosomal protein S28 [Pestalotiopsis fici W1... 102 5e-26 KKY30575.1 putative 40s ribosomal protein s28 [Diaporthe ampelina] 102 7e-26 OJJ48920.1 hypothetical protein ASPZODRAFT_149897 [Penicilliopsi... 102 1e-25 XP_003000163.1 40S ribosomal protein S28 [Verticillium alfalfae ... 102 1e-25 XP_003009124.1 40S ribosomal protein S28 [Verticillium alfalfae ... 102 1e-25 OCK76572.1 ribosomal protein S28e, partial [Lepidopterella palus... 101 1e-25 OCL01585.1 ribosomal protein S28e [Glonium stellatum] 101 1e-25 KKA26499.1 hypothetical protein TD95_004483 [Thielaviopsis punct... 101 1e-25 XP_007600844.1 40S ribosomal protein S28 [Colletotrichum fiorini... 101 1e-25 >XP_018381678.1 ribosomal protein S28e [Alternaria alternata] OAG16257.1 ribosomal protein S28e [Alternaria alternata] Length = 68 Score = 114 bits (286), Expect = 1e-30 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 56 >XP_001938519.1 40S ribosomal protein S28 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003304246.1 40S ribosomal protein S28 [Pyrenophora teres f. teres 0-1] XP_007684196.1 hypothetical protein COCMIDRAFT_33356 [Bipolaris oryzae ATCC 44560] XP_007703379.1 hypothetical protein COCSADRAFT_98221 [Bipolaris sorokiniana ND90Pr] XP_007714597.1 hypothetical protein COCCADRAFT_6973 [Bipolaris zeicola 26-R-13] XP_008029697.1 hypothetical protein SETTUDRAFT_165088 [Setosphaeria turcica Et28A] XP_014078919.1 hypothetical protein COCC4DRAFT_138898 [Bipolaris maydis ATCC 48331] XP_014555072.1 hypothetical protein COCVIDRAFT_103321 [Bipolaris victoriae FI3] EDU51106.1 40S ribosomal protein S28 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ87658.1 hypothetical protein PTT_16774 [Pyrenophora teres f. teres 0-1] EMD61042.1 hypothetical protein COCSADRAFT_98221 [Bipolaris sorokiniana ND90Pr] EMD89273.1 hypothetical protein COCHEDRAFT_1141328 [Bipolaris maydis C5] ENI05010.1 hypothetical protein COCC4DRAFT_138898 [Bipolaris maydis ATCC 48331] EOA82605.1 hypothetical protein SETTUDRAFT_165088 [Setosphaeria turcica Et28A] EUC31086.1 hypothetical protein COCCADRAFT_6973 [Bipolaris zeicola 26-R-13] EUC49303.1 hypothetical protein COCMIDRAFT_33356 [Bipolaris oryzae ATCC 44560] EUN25495.1 hypothetical protein COCVIDRAFT_103321 [Bipolaris victoriae FI3] KNG49437.1 40s ribosomal protein s28 [Stemphylium lycopersici] Length = 68 Score = 110 bits (275), Expect = 5e-29 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAKAPV LVKVTRVLGRTGSRGGVTQCRVEFM+DQTRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 56 >XP_001798512.1 hypothetical protein SNOG_08190 [Parastagonospora nodorum SN15] XP_003834465.1 hypothetical protein LEMA_P061340.1 [Leptosphaeria maculans JN3] EAT84466.1 hypothetical protein SNOG_08190 [Parastagonospora nodorum SN15] CBX91100.1 hypothetical protein LEMA_P061340.1 [Leptosphaeria maculans JN3] OAL00547.1 ribosomal protein S28e [Stagonospora sp. SRC1lsM3a] OAL49552.1 ribosomal protein S28e [Pyrenochaeta sp. DS3sAY3a] Length = 68 Score = 109 bits (272), Expect = 1e-28 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MD+AKAPV LVKVTRVLGRTGSRGGVTQCRVEFM+DQTRSIIRNVKGPVRENDILC Sbjct: 1 MDTAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGPVRENDILC 56 >XP_015402063.1 40S ribosomal protein S28, partial [Aspergillus nomius NRRL 13137] KNG81140.1 40S ribosomal protein S28, partial [Aspergillus nomius NRRL 13137] Length = 88 Score = 108 bits (270), Expect = 5e-28 Identities = 54/72 (75%), Positives = 62/72 (86%) Frame = -1 Query: 439 PYTERTDSRRNSQSHKMDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRN 260 P +++ +R +QS MDSAKAPV LVKVTRVLGRTGSRGGVTQ RVEFM+DQ+RSIIRN Sbjct: 5 PRLDQSQPQRENQSFAMDSAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQSRSIIRN 64 Query: 259 VKGPVRENDILC 224 VKGPVR +DILC Sbjct: 65 VKGPVRVDDILC 76 >KZL81386.1 40s ribosomal protein s28, partial [Colletotrichum incanum] Length = 106 Score = 108 bits (271), Expect = 5e-28 Identities = 55/81 (67%), Positives = 64/81 (79%) Frame = -1 Query: 466 HPRTPNPALPYTERTDSRRNSQSHKMDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMN 287 +P + +LP + + + + KMDSAK PV LVKVTRVLGRTGSRGGVTQ RVEFM+ Sbjct: 14 NPSPNSESLPKAQPSPAPSQPHTFKMDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMD 73 Query: 286 DQTRSIIRNVKGPVRENDILC 224 DQTRSIIRNVKGPVRE+DILC Sbjct: 74 DQTRSIIRNVKGPVREDDILC 94 >KZM27071.1 structural constituent of ribosome [Ascochyta rabiei] Length = 68 Score = 106 bits (264), Expect = 2e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MD+AKAPV LVKVTRVLGRTGSRGGVTQCRVEFM+DQTRSIIRNVKG VRENDILC Sbjct: 1 MDTAKAPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDQTRSIIRNVKGAVRENDILC 56 >XP_018030669.1 ribosomal protein S28e [Paraphaeosphaeria sporulosa] OAG00304.1 ribosomal protein S28e [Paraphaeosphaeria sporulosa] Length = 68 Score = 105 bits (262), Expect = 4e-27 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MD+AK PV LVKVTRVLGRTGSRGGVTQCRVEFM+D TRSIIRNVKGPVRENDILC Sbjct: 1 MDTAKVPVKLVKVTRVLGRTGSRGGVTQCRVEFMDDTTRSIIRNVKGPVRENDILC 56 >KUI56796.1 40S ribosomal protein S28 [Valsa mali var. pyri] KUI71137.1 40S ribosomal protein S28 [Valsa mali] Length = 68 Score = 103 bits (257), Expect = 2e-26 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDS+K PV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRENDILC Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVRENDILC 56 >XP_007915668.1 putative 40s ribosomal protein s28 protein [Phaeoacremonium minimum UCRPA7] XP_014541713.1 Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] XP_018145445.1 ribosomal protein s28e domain-containing protein [Pochonia chlamydosporia 170] XP_018183085.1 ribosomal protein s28e domain-containing protein [Purpureocillium lilacinum] CCE33319.1 probable ribosomal protein S28B [Claviceps purpurea 20.1] EON99563.1 putative 40s ribosomal protein s28 protein [Phaeoacremonium minimum UCRPA7] EXV03803.1 ribosomal protein S28e [Metarhizium robertsii] KFG85603.1 40S ribosomal protein S28 [Metarhizium anisopliae] KID69986.1 Ribosomal protein S28e, partial [Metarhizium anisopliae ARSEF 549] KID72508.1 Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] KID89430.1 Ribosomal protein S28e [Metarhizium guizhouense ARSEF 977] KJK75639.1 hypothetical protein H634G_09003 [Metarhizium anisopliae BRIP 53293] KJK93999.1 hypothetical protein H633G_02099 [Metarhizium anisopliae BRIP 53284] KJZ75767.1 40S ribosomal protein S28 [Hirsutella minnesotensis 3608] OAQ68595.1 ribosomal protein s28e domain-containing protein [Pochonia chlamydosporia 170] OAQ94366.1 ribosomal protein s28e domain-containing protein [Purpureocillium lilacinum] ODA78688.1 hypothetical protein RJ55_06070 [Drechmeria coniospora] Length = 68 Score = 103 bits (257), Expect = 2e-26 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDS+KAPV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >XP_002153086.1 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] XP_002487548.1 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] XP_002487549.1 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] XP_020118751.1 40S ribosomal protein S28 [Talaromyces atroroseus] EEA18701.1 Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] EED13437.1 Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] EED13438.1 Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] KFX52824.1 40S ribosomal protein S28 [Talaromyces marneffei PM1] GAM43411.1 ribosomal protein [Talaromyces cellulolyticus] CRG91631.1 hypothetical protein PISL3812_08681 [Talaromyces islandicus] KUL86410.1 hypothetical protein ZTR_08157 [Talaromyces verruculosus] OKL58630.1 40S ribosomal protein S28 [Talaromyces atroroseus] Length = 68 Score = 103 bits (256), Expect = 4e-26 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAK PV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >XP_020131267.1 40s ribosomal protein s28 [Diplodia corticola] XP_020128951.1 40s ribosomal protein s28 [Diplodia corticola] EKG14828.1 Ribosomal protein S28e [Macrophomina phaseolina MS6] EKG17607.1 Histone core [Macrophomina phaseolina MS6] KKY19538.1 putative 40s ribosomal protein s28 [Diplodia seriata] KKY20058.1 putative 40s ribosomal protein s28 [Diplodia seriata] OJD32691.1 40s ribosomal protein s28 [Diplodia corticola] OJD35007.1 40s ribosomal protein s28 [Diplodia corticola] OMP81426.1 40S ribosomal protein S28 [Diplodia seriata] OMP84080.1 40S ribosomal protein S28 [Diplodia seriata] Length = 68 Score = 102 bits (255), Expect = 5e-26 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAK PV LVKVTRVLGRTGSRGGVTQ RVEFM+D TRSIIRNVKGPVRENDILC Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >XP_007827699.1 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] XP_008099256.1 ribosomal protein S28e [Colletotrichum graminicola M1.001] XP_018163793.1 Ribosomal protein S28e [Colletotrichum higginsianum IMI 349063] EFQ35236.1 ribosomal protein S28e [Colletotrichum graminicola M1.001] CCF46007.1 40S ribosomal protein S28 [Colletotrichum higginsianum] ETS87099.1 40S ribosomal protein S28 [Pestalotiopsis fici W106-1] KDN65874.1 putative 40S ribosomal protein S28 [Colletotrichum sublineola] KZL71826.1 40S ribosomal protein S28 [Colletotrichum tofieldiae] OBR15276.1 Ribosomal protein S28e [Colletotrichum higginsianum IMI 349063] OHW93033.1 40s ribosomal protein s28 [Colletotrichum incanum] Length = 68 Score = 102 bits (255), Expect = 5e-26 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAK PV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >KKY30575.1 putative 40s ribosomal protein s28 [Diaporthe ampelina] Length = 68 Score = 102 bits (254), Expect = 7e-26 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MD++K PV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRENDILC Sbjct: 1 MDASKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVRENDILC 56 >OJJ48920.1 hypothetical protein ASPZODRAFT_149897 [Penicilliopsis zonata CBS 506.65] Length = 68 Score = 102 bits (253), Expect = 1e-25 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAKAPV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVR +DILC Sbjct: 1 MDSAKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVRVDDILC 56 >XP_003000163.1 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] XP_009652495.1 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] EEY23248.1 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] EGY23158.1 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] CEJ91264.1 Putative 40S ribosomal protein S28 [Torrubiella hemipterigena] CRK34680.1 hypothetical protein BN1708_016348 [Verticillium longisporum] Length = 68 Score = 102 bits (253), Expect = 1e-25 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDS+K PV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >XP_003009124.1 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] XP_009650088.1 hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] EEY14698.1 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] EGY13734.1 hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] CRK36463.1 hypothetical protein BN1708_007062 [Verticillium longisporum] CRK15241.1 hypothetical protein BN1708_011409 [Verticillium longisporum] CRK11466.1 hypothetical protein BN1723_001798 [Verticillium longisporum] Length = 68 Score = 102 bits (253), Expect = 1e-25 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDS+K PV LVKVTRVLGRTGSRGGVTQ RVEFM+DQTRSIIRNVKGPVRE+DILC Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDILC 56 >OCK76572.1 ribosomal protein S28e, partial [Lepidopterella palustris CBS 459.81] Length = 67 Score = 101 bits (252), Expect = 1e-25 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MD+AK PV LVKVTRVLGRTGSRGGVTQ RVEFM+D TRSIIRNVKGPVRENDILC Sbjct: 1 MDAAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >OCL01585.1 ribosomal protein S28e [Glonium stellatum] Length = 68 Score = 101 bits (252), Expect = 1e-25 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MD+AK PV LVKVTRVLGRTGSRGGVTQ RVEFM+D TRSIIRNVKGPVRENDILC Sbjct: 1 MDAAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDILC 56 >KKA26499.1 hypothetical protein TD95_004483 [Thielaviopsis punctulata] Length = 68 Score = 101 bits (252), Expect = 1e-25 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 M+SAK PV LVKVTRVLGRTGSRGGVTQ RVEFM+D TRSIIRNVKGPVRENDILC Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDNTRSIIRNVKGPVRENDILC 56 >XP_007600844.1 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] EXF75473.1 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] KXH44734.1 40S ribosomal protein S28 [Colletotrichum nymphaeae SA-01] KXH50833.1 40S ribosomal protein S28 [Colletotrichum simmondsii] KXH65883.1 40S ribosomal protein S28 [Colletotrichum salicis] OHE99604.1 40S ribosomal protein S28 [Colletotrichum orchidophilum] Length = 68 Score = 101 bits (252), Expect = 1e-25 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 391 MDSAKAPVNLVKVTRVLGRTGSRGGVTQCRVEFMNDQTRSIIRNVKGPVRENDILC 224 MDSAK PV LVKVTRVLGRTGSRGGVTQ RVEFM+D+TRSIIRNVKGPVRE+DILC Sbjct: 1 MDSAKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDILC 56