BLASTX nr result
ID: Papaver32_contig00033222
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00033222 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002303462.1 hypothetical protein POPTR_0003s09990g [Populus t... 62 3e-08 XP_006368311.1 hypothetical protein POPTR_0001s01500g [Populus t... 59 2e-07 XP_018852187.1 PREDICTED: transmembrane protein 45B-like isoform... 59 2e-07 XP_011018431.1 PREDICTED: transmembrane protein 45B-like [Populu... 59 3e-07 XP_007040793.2 PREDICTED: transmembrane protein 45A [Theobroma c... 58 5e-07 EOY25294.1 C globular stage isoform 1 [Theobroma cacao] EOY25295... 58 5e-07 XP_008448600.1 PREDICTED: transmembrane protein 45B [Cucumis mel... 58 7e-07 XP_004146117.1 PREDICTED: transmembrane protein 45B [Cucumis sat... 58 7e-07 XP_011028071.1 PREDICTED: transmembrane protein 45A [Populus eup... 58 7e-07 OMO87856.1 hypothetical protein CCACVL1_08731 [Corchorus capsula... 57 1e-06 XP_002263042.2 PREDICTED: LOW QUALITY PROTEIN: transmembrane pro... 57 1e-06 CAN68559.1 hypothetical protein VITISV_028486 [Vitis vinifera] 57 1e-06 XP_012475580.1 PREDICTED: transmembrane protein 45B-like [Gossyp... 57 2e-06 XP_015575134.1 PREDICTED: transmembrane protein 45B [Ricinus com... 57 2e-06 XP_018807655.1 PREDICTED: transmembrane protein 45B-like [Juglan... 56 2e-06 XP_020094517.1 transmembrane protein 45B [Ananas comosus] 56 3e-06 OAY81341.1 Transmembrane protein 45B [Ananas comosus] 56 3e-06 OMO93441.1 hypothetical protein COLO4_16872 [Corchorus olitorius] 56 3e-06 XP_017220094.1 PREDICTED: transmembrane protein 45A-like [Daucus... 55 8e-06 KDO40079.1 hypothetical protein CISIN_1g023730mg [Citrus sinensis] 55 9e-06 >XP_002303462.1 hypothetical protein POPTR_0003s09990g [Populus trichocarpa] EEE78441.1 hypothetical protein POPTR_0003s09990g [Populus trichocarpa] Length = 276 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLVFGV V YGFAASRYGHSDL Sbjct: 230 GELLANFQLFSLVFGVLVTVAASYGFAASRYGHSDL 265 >XP_006368311.1 hypothetical protein POPTR_0001s01500g [Populus trichocarpa] ERP64880.1 hypothetical protein POPTR_0001s01500g [Populus trichocarpa] Length = 276 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLA FQLFS+VFGV V YGFAASRYGHSDL Sbjct: 230 GELLATFQLFSMVFGVLVAVAAAYGFAASRYGHSDL 265 >XP_018852187.1 PREDICTED: transmembrane protein 45B-like isoform X1 [Juglans regia] Length = 279 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLV GV V+G Y FAASRYGHS+L Sbjct: 231 GELLANFQLFSLVLGVLVAVVGSYAFAASRYGHSEL 266 >XP_011018431.1 PREDICTED: transmembrane protein 45B-like [Populus euphratica] XP_011018432.1 PREDICTED: transmembrane protein 45B-like [Populus euphratica] Length = 276 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLA FQLFSLVFGV V YGFAASRYGHSDL Sbjct: 230 GELLATFQLFSLVFGVLVAVAVAYGFAASRYGHSDL 265 >XP_007040793.2 PREDICTED: transmembrane protein 45A [Theobroma cacao] XP_007040794.2 PREDICTED: transmembrane protein 45A [Theobroma cacao] Length = 274 Score = 58.2 bits (139), Expect = 5e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLV GV V+G YGFAASRY +SDL Sbjct: 230 GELLANFQLFSLVLGVLVAVVGSYGFAASRYANSDL 265 >EOY25294.1 C globular stage isoform 1 [Theobroma cacao] EOY25295.1 C globular stage isoform 1 [Theobroma cacao] Length = 274 Score = 58.2 bits (139), Expect = 5e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLV GV V+G YGFAASRY +SDL Sbjct: 230 GELLANFQLFSLVLGVLVAVVGSYGFAASRYANSDL 265 >XP_008448600.1 PREDICTED: transmembrane protein 45B [Cucumis melo] XP_008448603.1 PREDICTED: transmembrane protein 45B [Cucumis melo] XP_016900621.1 PREDICTED: transmembrane protein 45B [Cucumis melo] Length = 274 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFS+V GV GV+G Y FAAS+YG SDL Sbjct: 231 GELLANFQLFSMVIGVLGGVVGVYWFAASKYGRSDL 266 >XP_004146117.1 PREDICTED: transmembrane protein 45B [Cucumis sativus] XP_011650315.1 PREDICTED: transmembrane protein 45B [Cucumis sativus] XP_011650316.1 PREDICTED: transmembrane protein 45B [Cucumis sativus] KGN55698.1 hypothetical protein Csa_3G006600 [Cucumis sativus] Length = 274 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFS+V GV GV+G Y FAAS+YG SDL Sbjct: 231 GELLANFQLFSMVVGVLGGVIGVYWFAASKYGRSDL 266 >XP_011028071.1 PREDICTED: transmembrane protein 45A [Populus euphratica] XP_011028072.1 PREDICTED: transmembrane protein 45A [Populus euphratica] Length = 276 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLVFGV Y FAASRYGHSDL Sbjct: 230 GELLANFQLFSLVFGVLVTAAASYAFAASRYGHSDL 265 >OMO87856.1 hypothetical protein CCACVL1_08731 [Corchorus capsularis] Length = 274 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLV GV V+G YGFAASRYG SDL Sbjct: 230 GELLANFQLFSLVLGVLLLVVGSYGFAASRYGGSDL 265 >XP_002263042.2 PREDICTED: LOW QUALITY PROTEIN: transmembrane protein 45B [Vitis vinifera] Length = 278 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLF + FGV V+G YGFAASR+GH DL Sbjct: 230 GELLANFQLFIIAFGVLVAVVGSYGFAASRFGHPDL 265 >CAN68559.1 hypothetical protein VITISV_028486 [Vitis vinifera] Length = 301 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLF + FGV V+G YGFAASR+GH DL Sbjct: 230 GELLANFQLFIIAFGVLVAVVGSYGFAASRFGHPDL 265 >XP_012475580.1 PREDICTED: transmembrane protein 45B-like [Gossypium raimondii] XP_016681828.1 PREDICTED: transmembrane protein 45B-like [Gossypium hirsutum] XP_016681829.1 PREDICTED: transmembrane protein 45B-like [Gossypium hirsutum] XP_016681831.1 PREDICTED: transmembrane protein 45B-like [Gossypium hirsutum] KJB25158.1 hypothetical protein B456_004G179300 [Gossypium raimondii] KJB25159.1 hypothetical protein B456_004G179300 [Gossypium raimondii] KJB25160.1 hypothetical protein B456_004G179300 [Gossypium raimondii] KJB25161.1 hypothetical protein B456_004G179300 [Gossypium raimondii] KJB25162.1 hypothetical protein B456_004G179300 [Gossypium raimondii] KJB25163.1 hypothetical protein B456_004G179300 [Gossypium raimondii] Length = 272 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 G+L+ANFQLFSLV GV V+G Y FAASRYG+SDL Sbjct: 229 GQLIANFQLFSLVLGVLIAVVGLYNFAASRYGNSDL 264 >XP_015575134.1 PREDICTED: transmembrane protein 45B [Ricinus communis] EEF42460.1 Transmembrane protein 45a, putative [Ricinus communis] Length = 278 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLF+LV GV GV+ YGFAAS+YG SDL Sbjct: 230 GELLANFQLFALVLGVLVGVVVSYGFAASKYGRSDL 265 >XP_018807655.1 PREDICTED: transmembrane protein 45B-like [Juglans regia] XP_018807656.1 PREDICTED: transmembrane protein 45B-like [Juglans regia] Length = 276 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLV GV V+G Y FAASRY HS+L Sbjct: 230 GELLANFQLFSLVLGVLVAVVGSYAFAASRYRHSEL 265 >XP_020094517.1 transmembrane protein 45B [Ananas comosus] Length = 299 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLVF VF VLG Y AA+RYGH DL Sbjct: 232 GELLANFQLFSLVFLVFVFVLGSYAIAAARYGHPDL 267 >OAY81341.1 Transmembrane protein 45B [Ananas comosus] Length = 299 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSDL 110 GELLANFQLFSLVF VF VLG Y AA+RYGH DL Sbjct: 232 GELLANFQLFSLVFLVFVFVLGSYAIAAARYGHPDL 267 >OMO93441.1 hypothetical protein COLO4_16872 [Corchorus olitorius] Length = 274 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSD 107 GELLANFQLFSLV GV V+G YGFAASRYG SD Sbjct: 230 GELLANFQLFSLVLGVLLLVVGSYGFAASRYGGSD 264 >XP_017220094.1 PREDICTED: transmembrane protein 45A-like [Daucus carota subsp. sativus] XP_017220095.1 PREDICTED: transmembrane protein 45A-like [Daucus carota subsp. sativus] KZM84209.1 hypothetical protein DCAR_028244 [Daucus carota subsp. sativus] Length = 270 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSD 107 G+LLANFQLFS+VFG+ GV+G YGFAA +YG ++ Sbjct: 230 GQLLANFQLFSIVFGLMVGVVGSYGFAAKKYGQAE 264 >KDO40079.1 hypothetical protein CISIN_1g023730mg [Citrus sinensis] Length = 278 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 GELLANFQLFSLVFGVFAGVLGFYGFAASRYGHSD 107 GE LANFQLF+LVFGV AGV G Y F ASRYG+S+ Sbjct: 230 GEFLANFQLFALVFGVLAGVAGSYIFVASRYGNSE 264