BLASTX nr result
ID: Papaver32_contig00032937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00032937 (458 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEC77740.1 hypothetical protein OsI_16856 [Oryza sativa Indica G... 53 7e-07 XP_004515329.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha... 56 3e-06 XP_004515328.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha... 56 3e-06 XP_010246100.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha... 55 5e-06 OAY49438.1 hypothetical protein MANES_05G056300 [Manihot esculenta] 55 6e-06 XP_010246099.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha... 55 6e-06 >EEC77740.1 hypothetical protein OsI_16856 [Oryza sativa Indica Group] Length = 54 Score = 53.1 bits (126), Expect = 7e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +2 Query: 365 QILQSYGWDLLLGFIAMFYVLMVPYTKVEES 457 ++L+ YGWDLLLG IA FY +MVPYTKVEES Sbjct: 11 RLLREYGWDLLLGSIAAFYAVMVPYTKVEES 41 >XP_004515329.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase isoform X2 [Cicer arietinum] Length = 531 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 323 QITTMSSTDKNKPWQILQSYGWDLLLGFIAMFYVLMVPYTKVEES 457 ++ TM+S DK+ L+ YG+DLLLG IA FY+LMVPYTKVEES Sbjct: 33 KMKTMASNDKSA--NFLKHYGYDLLLGSIAAFYILMVPYTKVEES 75 >XP_004515328.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase isoform X1 [Cicer arietinum] Length = 533 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 323 QITTMSSTDKNKPWQILQSYGWDLLLGFIAMFYVLMVPYTKVEES 457 ++ TM+S DK+ L+ YG+DLLLG IA FY+LMVPYTKVEES Sbjct: 33 KMKTMASNDKSA--NFLKHYGYDLLLGSIAAFYILMVPYTKVEES 75 >XP_010246100.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase isoform X2 [Nelumbo nucifera] Length = 489 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 356 KPWQILQSYGWDLLLGFIAMFYVLMVPYTKVEES 457 K +I Q YGWDLLLG IA FYV MVPYTKVEES Sbjct: 4 KSSKIFQRYGWDLLLGSIAAFYVFMVPYTKVEES 37 >OAY49438.1 hypothetical protein MANES_05G056300 [Manihot esculenta] Length = 495 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 353 NKPWQILQSYGWDLLLGFIAMFYVLMVPYTKVEES 457 +K QIL+ YG+DLLLGFIA FYV VPYTKVEES Sbjct: 3 SKSCQILRQYGYDLLLGFIAAFYVFAVPYTKVEES 37 >XP_010246099.1 PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase isoform X1 [Nelumbo nucifera] Length = 500 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 356 KPWQILQSYGWDLLLGFIAMFYVLMVPYTKVEES 457 K +I Q YGWDLLLG IA FYV MVPYTKVEES Sbjct: 4 KSSKIFQRYGWDLLLGSIAAFYVFMVPYTKVEES 37