BLASTX nr result
ID: Papaver32_contig00032562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00032562 (710 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010920998.1 PREDICTED: plant intracellular Ras-group-related ... 44 1e-06 XP_016512723.1 PREDICTED: LRR repeats and ubiquitin-like domain-... 51 2e-06 XP_009802173.1 PREDICTED: LRR repeats and ubiquitin-like domain-... 51 2e-06 >XP_010920998.1 PREDICTED: plant intracellular Ras-group-related LRR protein 8 [Elaeis guineensis] Length = 379 Score = 43.9 bits (102), Expect(3) = 1e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +2 Query: 257 LLLLHSTESTIKDLESLLQPLTNVLPRVQKHIFKG 361 L L S + T++DL+SLLQPLT+V+PR QK IFKG Sbjct: 25 LRLSVSDDFTVRDLKSLLQPLTDVIPRGQKLIFKG 59 Score = 32.7 bits (73), Expect(3) = 1e-06 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 4/39 (10%) Frame = +1 Query: 442 GKVLEDTMKLKSQMGLS----ICMAS*GVHQGGK*IRKI 546 GKVL DTMKLKS+ + + +AS G+HQG I K+ Sbjct: 59 GKVLTDTMKLKSEQVIDGSKIMLIASQGLHQGDGPITKV 97 Score = 23.1 bits (48), Expect(3) = 1e-06 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 617 DGPITKQVVSSGSGLRKPSGNAQGLMDSK 703 DGPITK S PS N + + DSK Sbjct: 91 DGPITKVTTS-------PSTNTRRIFDSK 112 >XP_016512723.1 PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Nicotiana tabacum] Length = 377 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 272 STESTIKDLESLLQPLTNVLPRVQKHIFKG 361 S EST+KDL+SLLQPLTNVLPR QK IFKG Sbjct: 33 SDESTVKDLKSLLQPLTNVLPRGQKLIFKG 62 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +1 Query: 442 GKVLEDTMKLKSQMGLS----ICMAS*GVHQGGK*IRK 543 GKVL D M LKS ++ + MAS G+HQG IRK Sbjct: 62 GKVLVDEMTLKSSEVVNGAKIMLMASQGLHQGDGPIRK 99 >XP_009802173.1 PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105 [Nicotiana sylvestris] Length = 377 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 272 STESTIKDLESLLQPLTNVLPRVQKHIFKG 361 S EST+KDL+SLLQPLTNVLPR QK IFKG Sbjct: 33 SDESTVKDLKSLLQPLTNVLPRGQKLIFKG 62 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +1 Query: 442 GKVLEDTMKLKSQMGLS----ICMAS*GVHQGGK*IRK 543 GKVL D M LKS ++ + MAS G+HQG IRK Sbjct: 62 GKVLVDEMTLKSSEVVNGAKIMLMASQGLHQGDGPIRK 99