BLASTX nr result
ID: Papaver32_contig00031852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00031852 (994 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU19584.1 hypothetical protein MIMGU_mgv1a014799mg [Erythranthe... 60 2e-07 NP_001237822.1 uncharacterized protein LOC100499910 [Glycine max... 60 2e-07 EYU19583.1 hypothetical protein MIMGU_mgv1a014799mg [Erythranthe... 60 3e-07 XP_010676422.1 PREDICTED: 40S ribosomal protein S10-1 [Beta vulg... 60 3e-07 XP_012858609.1 PREDICTED: 40S ribosomal protein S10-1-like [Eryt... 60 3e-07 XP_012852180.1 PREDICTED: 40S ribosomal protein S10-1 [Erythrant... 60 3e-07 XP_010276891.1 PREDICTED: 40S ribosomal protein S10-1-like [Nelu... 60 3e-07 XP_010671623.1 PREDICTED: 40S ribosomal protein S10-1 [Beta vulg... 60 4e-07 BAU00590.1 hypothetical protein VIGAN_10219900 [Vigna angularis ... 60 4e-07 KYP67320.1 40S ribosomal protein S10-1, partial [Cajanus cajan] 60 4e-07 XP_006382656.1 40S ribosomal protein S10-1 [Populus trichocarpa]... 59 5e-07 KYP58642.1 40S ribosomal protein S10 [Cajanus cajan] 60 6e-07 XP_008360678.1 PREDICTED: 40S ribosomal protein S10-1-like [Malu... 59 6e-07 XP_015896452.1 PREDICTED: 40S ribosomal protein S10-3-like [Zizi... 57 6e-07 KOM27100.1 hypothetical protein LR48_Vigan401s001000 [Vigna angu... 60 6e-07 XP_017237840.1 PREDICTED: 40S ribosomal protein S10-1-like [Dauc... 59 7e-07 XP_017244322.1 PREDICTED: 40S ribosomal protein S10-1-like [Dauc... 59 7e-07 XP_017254924.1 PREDICTED: 40S ribosomal protein S10-3-like [Dauc... 59 7e-07 KNA22894.1 hypothetical protein SOVF_029460 [Spinacia oleracea] 59 8e-07 AFK48711.1 unknown [Lotus japonicus] 59 8e-07 >EYU19584.1 hypothetical protein MIMGU_mgv1a014799mg [Erythranthe guttata] Length = 162 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >NP_001237822.1 uncharacterized protein LOC100499910 [Glycine max] ACU14142.1 unknown [Glycine max] Length = 183 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHP+ID+PNL+VIKLTQSFKS EYVR Sbjct: 25 KDFNLAKHPEIDVPNLQVIKLTQSFKSREYVR 56 >EYU19583.1 hypothetical protein MIMGU_mgv1a014799mg [Erythranthe guttata] Length = 174 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_010676422.1 PREDICTED: 40S ribosomal protein S10-1 [Beta vulgaris subsp. vulgaris] KMT12039.1 hypothetical protein BVRB_5g099980 [Beta vulgaris subsp. vulgaris] Length = 177 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_012858609.1 PREDICTED: 40S ribosomal protein S10-1-like [Erythranthe guttata] EYU19582.1 hypothetical protein MIMGU_mgv1a014799mg [Erythranthe guttata] Length = 178 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_012852180.1 PREDICTED: 40S ribosomal protein S10-1 [Erythranthe guttata] EYU25149.1 hypothetical protein MIMGU_mgv1a014769mg [Erythranthe guttata] Length = 179 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_010276891.1 PREDICTED: 40S ribosomal protein S10-1-like [Nelumbo nucifera] Length = 180 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_010671623.1 PREDICTED: 40S ribosomal protein S10-1 [Beta vulgaris subsp. vulgaris] KMT16174.1 hypothetical protein BVRB_3g053340 [Beta vulgaris subsp. vulgaris] Length = 188 Score = 60.1 bits (144), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >BAU00590.1 hypothetical protein VIGAN_10219900 [Vigna angularis var. angularis] Length = 179 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPDIDVPNLQVIKLMQSFKSREYVR 56 >KYP67320.1 40S ribosomal protein S10-1, partial [Cajanus cajan] Length = 184 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 27 KDFNLAKHPDIDVPNLQVIKLMQSFKSREYVR 58 >XP_006382656.1 40S ribosomal protein S10-1 [Populus trichocarpa] ERP60453.1 40S ribosomal protein S10-1 [Populus trichocarpa] Length = 140 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHP+ID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDFNLAKHPEIDVPNLQVIKLMQSFKSKEYVR 56 >KYP58642.1 40S ribosomal protein S10 [Cajanus cajan] Length = 203 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 47 KDFNLAKHPDIDVPNLQVIKLMQSFKSREYVR 78 >XP_008360678.1 PREDICTED: 40S ribosomal protein S10-1-like [Malus domestica] Length = 168 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_015896452.1 PREDICTED: 40S ribosomal protein S10-3-like [Ziziphus jujuba] Length = 109 Score = 57.4 bits (137), Expect = 6e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHP+ID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPEIDVPNLQVIKLMQSFKSKEYVR 56 >KOM27100.1 hypothetical protein LR48_Vigan401s001000 [Vigna angularis] Length = 208 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +DFNLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 34 KDFNLAKHPDIDVPNLQVIKLMQSFKSREYVR 65 >XP_017237840.1 PREDICTED: 40S ribosomal protein S10-1-like [Daucus carota subsp. sativus] KZN01903.1 hypothetical protein DCAR_010657 [Daucus carota subsp. sativus] Length = 176 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_017244322.1 PREDICTED: 40S ribosomal protein S10-1-like [Daucus carota subsp. sativus] KZM98117.1 hypothetical protein DCAR_014521 [Daucus carota subsp. sativus] Length = 176 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >XP_017254924.1 PREDICTED: 40S ribosomal protein S10-3-like [Daucus carota subsp. sativus] KZM92363.1 hypothetical protein DCAR_020272 [Daucus carota subsp. sativus] Length = 177 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >KNA22894.1 hypothetical protein SOVF_029460 [Spinacia oleracea] Length = 178 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56 >AFK48711.1 unknown [Lotus japonicus] Length = 178 Score = 58.9 bits (141), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 263 RDFNLAKHPDIDMPNLKVIKLTQSFKSSEYVR 358 +D+NLAKHPDID+PNL+VIKL QSFKS EYVR Sbjct: 25 KDYNLAKHPDIDVPNLQVIKLMQSFKSKEYVR 56