BLASTX nr result
ID: Papaver32_contig00030985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00030985 (746 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010246879.1 PREDICTED: protein YLS7-like isoform X3 [Nelumbo ... 57 8e-06 >XP_010246879.1 PREDICTED: protein YLS7-like isoform X3 [Nelumbo nucifera] Length = 487 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +2 Query: 506 PKSLTSIVVSVGGLALFVIFASWLLISNPASSPVNGSSLFSISNNSTK 649 P++L SIV+SVGGLALF+IFASWLLIS P+ S G +S +S++ Sbjct: 5 PRTLASIVISVGGLALFLIFASWLLISYPSGSTFQGEKTKLVSTDSSR 52