BLASTX nr result
ID: Papaver32_contig00030857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00030857 (585 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJK38608.1 hypothetical protein BG08_7002 (plasmid) [Bacillus th... 54 2e-06 >AJK38608.1 hypothetical protein BG08_7002 (plasmid) [Bacillus thuringiensis serovar kurstaki] AJK38620.1 hypothetical protein BG08_7026 (plasmid) [Bacillus thuringiensis serovar kurstaki] Length = 109 Score = 54.3 bits (129), Expect = 2e-06 Identities = 39/95 (41%), Positives = 47/95 (49%), Gaps = 4/95 (4%) Frame = +2 Query: 197 YHQQCHISSTQPPVPCHFLVIPVAN*YHLSLPNTHMFFCSHNTLPQNPSQFFSNPPVMAP 376 YH Q + S P+P H +IP +HLSLPNTH SHN + S S PPV+ Sbjct: 23 YHAQNYSHSAFSPLPFHSHIIP----HHLSLPNTH----SHNHI---KSSLSSIPPVLPS 71 Query: 377 LNSKHHQFSLP---TPAPQLP-QTHLNCKFISPRH 469 L + Q S P TP P LP QTH N + H Sbjct: 72 LLISYKQLSFPNQKTPVPVLPIQTHANLPTLLSLH 106