BLASTX nr result
ID: Papaver32_contig00030390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00030390 (650 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015902955.1 PREDICTED: auxin-induced protein 6B-like [Ziziphu... 55 3e-06 XP_015884808.1 PREDICTED: auxin-induced protein 6B [Ziziphus juj... 55 3e-06 XP_018818432.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 55 4e-06 XP_018807019.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 55 4e-06 XP_013466175.1 SAUR-like auxin-responsive family protein [Medica... 54 9e-06 >XP_015902955.1 PREDICTED: auxin-induced protein 6B-like [Ziziphus jujuba] Length = 151 Score = 55.5 bits (132), Expect = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +1 Query: 1 RYCHVGLSAKFDFWPESRPLLHTLSEKSVW 90 RYCHVG+ + DFWP+SRPLLH +EKS+W Sbjct: 122 RYCHVGIRSNLDFWPDSRPLLHGFAEKSIW 151 >XP_015884808.1 PREDICTED: auxin-induced protein 6B [Ziziphus jujuba] Length = 151 Score = 55.5 bits (132), Expect = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = +1 Query: 1 RYCHVGLSAKFDFWPESRPLLHTLSEKSVW 90 RYCHVG+ + DFWP+SRPLLH +EKS+W Sbjct: 122 RYCHVGIRSNLDFWPDSRPLLHGFAEKSIW 151 >XP_018818432.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 150 Score = 55.1 bits (131), Expect = 4e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +1 Query: 4 YCHVGLSAKFDFWPESRPLLHTLSEKSVW 90 YCHVG+ +K DFW ESRPLLH L+EKS+W Sbjct: 122 YCHVGIRSKLDFWAESRPLLHGLTEKSIW 150 >XP_018807019.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 150 Score = 55.1 bits (131), Expect = 4e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +1 Query: 4 YCHVGLSAKFDFWPESRPLLHTLSEKSVW 90 YCHVG+ +K DFW ESRPLLH L+EKS+W Sbjct: 122 YCHVGIRSKLDFWAESRPLLHGLTEKSIW 150 >XP_013466175.1 SAUR-like auxin-responsive family protein [Medicago truncatula] KEH40216.1 SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 146 Score = 53.9 bits (128), Expect = 9e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +1 Query: 1 RYCHVGLSAKFDFWPESRPLLHTLSEKSVW 90 R CHVG+ DFWPESRPLLH LSEK++W Sbjct: 117 RRCHVGIRTNVDFWPESRPLLHGLSEKTIW 146