BLASTX nr result
ID: Papaver32_contig00029696
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00029696 (467 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011072673.1 PREDICTED: 17.4 kDa class III heat shock protein ... 57 3e-07 XP_010917421.1 PREDICTED: 17.4 kDa class III heat shock protein ... 57 4e-07 XP_016562442.1 PREDICTED: 17.4 kDa class III heat shock protein ... 56 4e-07 KNA07362.1 hypothetical protein SOVF_172620 [Spinacia oleracea] 55 9e-07 XP_015069126.1 PREDICTED: 17.4 kDa class III heat shock protein ... 55 1e-06 XP_004235534.1 PREDICTED: 17.4 kDa class III heat shock protein ... 55 1e-06 XP_006342905.1 PREDICTED: 17.4 kDa class III heat shock protein ... 55 2e-06 CDO97809.1 unnamed protein product [Coffea canephora] 55 2e-06 XP_002529170.1 PREDICTED: 17.4 kDa class III heat shock protein ... 54 3e-06 XP_008392095.1 PREDICTED: 17.4 kDa class III heat shock protein ... 54 3e-06 AAK84869.1 small heat stress protein class CIII [Solanum peruvia... 54 3e-06 XP_019198342.1 PREDICTED: 17.4 kDa class III heat shock protein ... 54 3e-06 GAV61403.1 HSP20 domain-containing protein [Cephalotus follicula... 54 3e-06 XP_009357908.1 PREDICTED: 17.4 kDa class III heat shock protein-... 54 4e-06 OAY36351.1 hypothetical protein MANES_11G014800 [Manihot esculen... 53 7e-06 XP_010029482.1 PREDICTED: 17.4 kDa class III heat shock protein ... 53 7e-06 XP_003627410.1 cytosolic class II small heat-shock protein [Medi... 53 9e-06 >XP_011072673.1 PREDICTED: 17.4 kDa class III heat shock protein [Sesamum indicum] Length = 154 Score = 56.6 bits (135), Expect = 3e-07 Identities = 29/48 (60%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEE------ENAERKSAAGQ 457 VDILDTPKEY+F+ DVPGLSK+DIQV V EE N +RK G+ Sbjct: 45 VDILDTPKEYIFYMDVPGLSKSDIQVTVEEENTLVIKSNGKRKREDGE 92 >XP_010917421.1 PREDICTED: 17.4 kDa class III heat shock protein [Elaeis guineensis] Length = 167 Score = 56.6 bits (135), Expect = 4e-07 Identities = 29/48 (60%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEE------NAERKSAAGQ 457 VDIL+TPKEY F FDVPGLSKTDIQV + E+E N +RK G+ Sbjct: 57 VDILETPKEYTFFFDVPGLSKTDIQVTLEEDEILVIKSNGKRKREEGE 104 >XP_016562442.1 PREDICTED: 17.4 kDa class III heat shock protein [Capsicum annuum] Length = 148 Score = 56.2 bits (134), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEEN 430 VDILD PKEY+FH DVPGLSK+DIQV V EEEN Sbjct: 39 VDILDAPKEYIFHMDVPGLSKSDIQVTV-EEEN 70 >KNA07362.1 hypothetical protein SOVF_172620 [Spinacia oleracea] Length = 153 Score = 55.5 bits (132), Expect = 9e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 326 PAVDILDTPKEYVFHFDVPGLSKTDIQVNVIEEENAERKSAAGQ 457 P DIL TPKEY+FH DVPGLSK+DIQV +E+EN A+G+ Sbjct: 43 PLADILSTPKEYIFHVDVPGLSKSDIQVQ-LEDENVLVIKASGK 85 >XP_015069126.1 PREDICTED: 17.4 kDa class III heat shock protein [Solanum pennellii] Length = 144 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEE 427 VDILDTPKEY+F+ DVPGLSK+DIQV+V +E+ Sbjct: 35 VDILDTPKEYIFYMDVPGLSKSDIQVSVEDEK 66 >XP_004235534.1 PREDICTED: 17.4 kDa class III heat shock protein [Solanum lycopersicum] Length = 144 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEE 427 VDILDTPKEY+F+ DVPGLSK+DIQV+V +E+ Sbjct: 35 VDILDTPKEYIFYMDVPGLSKSDIQVSVEDEK 66 >XP_006342905.1 PREDICTED: 17.4 kDa class III heat shock protein [Solanum tuberosum] Length = 147 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEEN 430 VDILDTPKEY+F+ DVPGLSK+DIQV V E+EN Sbjct: 38 VDILDTPKEYIFYMDVPGLSKSDIQVTV-EDEN 69 >CDO97809.1 unnamed protein product [Coffea canephora] Length = 159 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 6/50 (12%) Frame = +2 Query: 326 PAVDILDTPKEYVFHFDVPGLSKTDIQVNVIEE------ENAERKSAAGQ 457 PAVDILD+PK YVF+ DVPGLSK+DIQV + +E N +RK G+ Sbjct: 48 PAVDILDSPKAYVFYVDVPGLSKSDIQVTLEDENTLVIRSNGKRKREDGE 97 >XP_002529170.1 PREDICTED: 17.4 kDa class III heat shock protein [Ricinus communis] EEF33184.1 heat-shock protein, putative [Ricinus communis] Length = 155 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEENAERKS 445 VDILDT KEY+FH DVPGLSK+DIQV V +E KS Sbjct: 46 VDILDTSKEYIFHMDVPGLSKSDIQVTVEDESTLVIKS 83 >XP_008392095.1 PREDICTED: 17.4 kDa class III heat shock protein [Malus domestica] XP_008392096.1 PREDICTED: 17.4 kDa class III heat shock protein [Malus domestica] Length = 156 Score = 54.3 bits (129), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 6/48 (12%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEE------ENAERKSAAGQ 457 VDILDTPKEY+F DVPGLSK+DIQV V +E N +RK G+ Sbjct: 47 VDILDTPKEYIFFLDVPGLSKSDIQVTVEDENTLVIRSNGKRKREDGE 94 >AAK84869.1 small heat stress protein class CIII [Solanum peruvianum] Length = 144 Score = 53.9 bits (128), Expect = 3e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEE 427 VDILDTPKEY+F+ DVPGLSK+D+QV+V +E+ Sbjct: 35 VDILDTPKEYIFYMDVPGLSKSDLQVSVEDEK 66 >XP_019198342.1 PREDICTED: 17.4 kDa class III heat shock protein [Ipomoea nil] XP_019198343.1 PREDICTED: 17.4 kDa class III heat shock protein [Ipomoea nil] Length = 149 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 335 DILDTPKEYVFHFDVPGLSKTDIQVNVIEEENAERKS 445 DILDTPKEYVF+ DVPGLSK+DIQV V +E KS Sbjct: 43 DILDTPKEYVFYLDVPGLSKSDIQVGVEDERTLVIKS 79 >GAV61403.1 HSP20 domain-containing protein [Cephalotus follicularis] Length = 133 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEEEN 430 VDILDTPK+++F+ DVPGLSK+DIQV VIE+EN Sbjct: 26 VDILDTPKDFIFYIDVPGLSKSDIQV-VIEDEN 57 >XP_009357908.1 PREDICTED: 17.4 kDa class III heat shock protein-like [Pyrus x bretschneideri] XP_009357923.1 PREDICTED: 17.4 kDa class III heat shock protein-like [Pyrus x bretschneideri] XP_018503322.1 PREDICTED: 17.4 kDa class III heat shock protein-like [Pyrus x bretschneideri] XP_018503325.1 PREDICTED: 17.4 kDa class III heat shock protein-like [Pyrus x bretschneideri] Length = 156 Score = 53.9 bits (128), Expect = 4e-06 Identities = 27/48 (56%), Positives = 33/48 (68%), Gaps = 6/48 (12%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEE------ENAERKSAAGQ 457 VDILDTPKEY+F DVPGLSK+D+QV V +E N +RK G+ Sbjct: 47 VDILDTPKEYIFFLDVPGLSKSDVQVTVEDENTLVIRSNGKRKREDGE 94 >OAY36351.1 hypothetical protein MANES_11G014800 [Manihot esculenta] OAY36352.1 hypothetical protein MANES_11G014800 [Manihot esculenta] Length = 155 Score = 53.1 bits (126), Expect = 7e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 335 DILDTPKEYVFHFDVPGLSKTDIQVNVIEEEN 430 DILDTPKEY+F+ DVPGLSK+DIQV V E+EN Sbjct: 47 DILDTPKEYIFYMDVPGLSKSDIQVTV-EDEN 77 >XP_010029482.1 PREDICTED: 17.4 kDa class III heat shock protein [Eucalyptus grandis] KCW56409.1 hypothetical protein EUGRSUZ_I02136 [Eucalyptus grandis] Length = 159 Score = 53.1 bits (126), Expect = 7e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +2 Query: 335 DILDTPKEYVFHFDVPGLSKTDIQVNVIEEENA 433 DIL+TPKEYVF+FDVPGLSK+D+QV V +++ + Sbjct: 50 DILETPKEYVFYFDVPGLSKSDVQVTVEDDQKS 82 >XP_003627410.1 cytosolic class II small heat-shock protein [Medicago truncatula] AET01886.1 cytosolic class II small heat-shock protein [Medicago truncatula] Length = 150 Score = 52.8 bits (125), Expect = 9e-06 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +2 Query: 332 VDILDTPKEYVFHFDVPGLSKTDIQVNVIEE------ENAERKSAAGQN 460 VDILDTPKEY+F DVPGLSK++IQV + +E N +RK G++ Sbjct: 41 VDILDTPKEYIFFLDVPGLSKSEIQVTIEDENTLVIKSNGKRKRQDGED 89