BLASTX nr result
ID: Papaver32_contig00029377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00029377 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF50784.1 conserved hypothetical protein [Ricinus communis] 54 5e-06 >EEF50784.1 conserved hypothetical protein [Ricinus communis] Length = 206 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 294 HADQLGMTWTFNNRAFC*QTLIGGNYYLLNTTT 196 + DQLGMT TFN++ FC QTLIGGNY LLNTTT Sbjct: 129 YLDQLGMTSTFNHKVFCRQTLIGGNYGLLNTTT 161