BLASTX nr result
ID: Papaver32_contig00029174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00029174 (492 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019228092.1 PREDICTED: long chain acyl-CoA synthetase 4-like ... 60 2e-07 XP_009783796.1 PREDICTED: long chain acyl-CoA synthetase 4-like ... 60 2e-07 XP_009627714.1 PREDICTED: long chain acyl-CoA synthetase 4-like ... 60 2e-07 XP_018456626.1 PREDICTED: long chain acyl-CoA synthetase 3 isofo... 58 7e-07 JAU91279.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescens] 58 7e-07 JAU42403.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescen... 58 7e-07 JAU24701.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescens] 58 7e-07 XP_018456625.1 PREDICTED: long chain acyl-CoA synthetase 3 isofo... 58 7e-07 XP_013664517.1 PREDICTED: long chain acyl-CoA synthetase 3 [Bras... 58 7e-07 XP_013611629.1 PREDICTED: long chain acyl-CoA synthetase 3 [Bras... 58 7e-07 XP_010473705.1 PREDICTED: long chain acyl-CoA synthetase 3-like ... 58 7e-07 XP_010430575.1 PREDICTED: long chain acyl-CoA synthetase 3 [Came... 58 7e-07 XP_010418506.1 PREDICTED: long chain acyl-CoA synthetase 3 [Came... 58 7e-07 XP_009112876.1 PREDICTED: long chain acyl-CoA synthetase 3 [Bras... 58 7e-07 XP_006391620.1 hypothetical protein EUTSA_v10023330mg [Eutrema s... 58 7e-07 XP_006300830.1 hypothetical protein CARUB_v10019918mg [Capsella ... 58 7e-07 CDY46530.1 BnaC09g11030D [Brassica napus] 58 7e-07 CDY64879.1 BnaAnng19690D [Brassica napus] 58 7e-07 XP_020105335.1 long chain acyl-CoA synthetase 4-like [Ananas com... 58 9e-07 OMP02937.1 AMP-dependent synthetase/ligase [Corchorus olitorius] 58 9e-07 >XP_019228092.1 PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana attenuata] OIT07412.1 long chain acyl-coa synthetase 4 [Nicotiana attenuata] Length = 658 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 125 ISSVAYDLI*NNEQLTDKDVYMSYLPLAHIFDRVIEELFI 6 IS V + + NE+ TDKDVY+SYLPLAHIFDRVIEELFI Sbjct: 251 ISGVNHHMETMNEEFTDKDVYLSYLPLAHIFDRVIEELFI 290 >XP_009783796.1 PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana sylvestris] XP_016508574.1 PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana tabacum] Length = 658 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 125 ISSVAYDLI*NNEQLTDKDVYMSYLPLAHIFDRVIEELFI 6 IS V + + NE+ TDKDVY+SYLPLAHIFDRVIEELFI Sbjct: 251 ISGVNHHMETMNEEFTDKDVYLSYLPLAHIFDRVIEELFI 290 >XP_009627714.1 PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana tomentosiformis] XP_016456848.1 PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana tabacum] Length = 658 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 125 ISSVAYDLI*NNEQLTDKDVYMSYLPLAHIFDRVIEELFI 6 IS V + + NE+ TDKDVY+SYLPLAHIFDRVIEELFI Sbjct: 251 ISGVNHHMETMNEEFTDKDVYLSYLPLAHIFDRVIEELFI 290 >XP_018456626.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] XP_018456627.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] XP_018456628.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] XP_018456629.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] XP_018456630.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] XP_018456631.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] XP_018456632.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X2 [Raphanus sativus] Length = 598 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 201 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 230 >JAU91279.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescens] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >JAU42403.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescens] JAU59758.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescens] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >JAU24701.1 Long chain acyl-CoA synthetase 3 [Noccaea caerulescens] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_018456625.1 PREDICTED: long chain acyl-CoA synthetase 3 isoform X1 [Raphanus sativus] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_013664517.1 PREDICTED: long chain acyl-CoA synthetase 3 [Brassica napus] XP_013664518.1 PREDICTED: long chain acyl-CoA synthetase 3 [Brassica napus] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_013611629.1 PREDICTED: long chain acyl-CoA synthetase 3 [Brassica oleracea var. oleracea] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_010473705.1 PREDICTED: long chain acyl-CoA synthetase 3-like [Camelina sativa] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_010430575.1 PREDICTED: long chain acyl-CoA synthetase 3 [Camelina sativa] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_010418506.1 PREDICTED: long chain acyl-CoA synthetase 3 [Camelina sativa] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_009112876.1 PREDICTED: long chain acyl-CoA synthetase 3 [Brassica rapa] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_006391620.1 hypothetical protein EUTSA_v10023330mg [Eutrema salsugineum] ESQ28906.1 hypothetical protein EUTSA_v10023330mg [Eutrema salsugineum] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >XP_006300830.1 hypothetical protein CARUB_v10019918mg [Capsella rubella] EOA33728.1 hypothetical protein CARUB_v10019918mg [Capsella rubella] Length = 660 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 >CDY46530.1 BnaC09g11030D [Brassica napus] Length = 786 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 263 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 292 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 389 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 418 >CDY64879.1 BnaAnng19690D [Brassica napus] Length = 960 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 420 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 449 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFIH 3 NE+LT KDVY+SYLPLAHIFDRVIEELFI+ Sbjct: 563 NEELTSKDVYLSYLPLAHIFDRVIEELFIY 592 >XP_020105335.1 long chain acyl-CoA synthetase 4-like [Ananas comosus] Length = 655 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 125 ISSVAYDLI*NNEQLTDKDVYMSYLPLAHIFDRVIEELFI 6 IS +A+ L NEQ+T+ DVY+SYLPLAHIFDRVIEE FI Sbjct: 248 ISGIAHVLEYVNEQVTENDVYLSYLPLAHIFDRVIEEFFI 287 >OMP02937.1 AMP-dependent synthetase/ligase [Corchorus olitorius] Length = 662 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 92 NEQLTDKDVYMSYLPLAHIFDRVIEELFI 6 NEQLT KDVY+SYLPLAHIFDRVIEELFI Sbjct: 262 NEQLTAKDVYLSYLPLAHIFDRVIEELFI 290