BLASTX nr result
ID: Papaver32_contig00028554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00028554 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN05720.1 hypothetical protein glysoja_024686 [Glycine soja] 54 7e-07 NP_001235184.1 uncharacterized protein LOC100526863 [Glycine max... 54 7e-07 XP_003606464.1 hypothetical protein MTR_4g060620 [Medicago trunc... 53 2e-06 XP_019453992.1 PREDICTED: uncharacterized protein LOC109355341 [... 53 2e-06 XP_003538047.1 PREDICTED: uncharacterized protein LOC100793196 [... 52 7e-06 >KHN05720.1 hypothetical protein glysoja_024686 [Glycine soja] Length = 90 Score = 54.3 bits (129), Expect = 7e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 30 MQSVLSLHCSYGLPLCISGIKNPLVLPKEIADHE 131 MQS+L+L ++GLPLC+SGI +PL LPKE+ADHE Sbjct: 1 MQSMLNLRATHGLPLCLSGITHPLALPKEMADHE 34 >NP_001235184.1 uncharacterized protein LOC100526863 [Glycine max] ACU15872.1 unknown [Glycine max] KRH24923.1 hypothetical protein GLYMA_12G071500 [Glycine max] Length = 90 Score = 54.3 bits (129), Expect = 7e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 30 MQSVLSLHCSYGLPLCISGIKNPLVLPKEIADHE 131 MQS+L+L ++GLPLC+SGI +PL LPKE+ADHE Sbjct: 1 MQSMLNLRATHGLPLCLSGITHPLALPKEMADHE 34 >XP_003606464.1 hypothetical protein MTR_4g060620 [Medicago truncatula] AES88661.1 hypothetical protein MTR_4g060620 [Medicago truncatula] Length = 94 Score = 53.1 bits (126), Expect = 2e-06 Identities = 35/101 (34%), Positives = 50/101 (49%) Frame = +3 Query: 30 MQSVLSLHCSYGLPLCISGIKNPLVLPKEIADHEXXXXXXXXXXXXXXSSLESVSNFVAD 209 MQS+L+L ++G+PLC+SGI NPL L KE+ADH+ + + + Sbjct: 1 MQSMLNLRATHGVPLCLSGITNPLALSKEMADHDRRRKDMRKQRSVHANQEKGAQS---- 56 Query: 210 LSISRSGIRVEMIDESKNEDLIEDLNDLISKCIIDHAAKAA 332 R VEM + EDL E L+ L + +AKAA Sbjct: 57 ---QRKNDFVEMKGDDDLEDLDEILHQLSFTYLTGLSAKAA 94 >XP_019453992.1 PREDICTED: uncharacterized protein LOC109355341 [Lupinus angustifolius] OIW05791.1 hypothetical protein TanjilG_23577 [Lupinus angustifolius] Length = 96 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/34 (61%), Positives = 30/34 (88%) Frame = +3 Query: 30 MQSVLSLHCSYGLPLCISGIKNPLVLPKEIADHE 131 MQS+++LH ++G+PLC+SGI NPL L KE+ADH+ Sbjct: 1 MQSMINLHANHGVPLCLSGITNPLALSKEMADHD 34 >XP_003538047.1 PREDICTED: uncharacterized protein LOC100793196 [Glycine max] KHN21431.1 hypothetical protein glysoja_050350 [Glycine soja] KRG89030.1 hypothetical protein GLYMA_U020200 [Glycine max] Length = 103 Score = 52.0 bits (123), Expect = 7e-06 Identities = 21/34 (61%), Positives = 30/34 (88%) Frame = +3 Query: 30 MQSVLSLHCSYGLPLCISGIKNPLVLPKEIADHE 131 MQS+L+L ++G+PLC+SGI +PL LPKE+ADH+ Sbjct: 1 MQSMLNLRATHGVPLCLSGITHPLTLPKEMADHD 34