BLASTX nr result
ID: Papaver32_contig00028392
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00028392 (586 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004300808.1 PREDICTED: BTB/POZ domain-containing protein At1g... 107 2e-23 XP_010919095.1 PREDICTED: BTB/POZ domain-containing protein At1g... 105 4e-23 XP_009363413.1 PREDICTED: BTB/POZ domain-containing protein At1g... 105 5e-23 ONI07175.1 hypothetical protein PRUPE_5G104400 [Prunus persica] 105 6e-23 XP_007210316.1 hypothetical protein PRUPE_ppa002210mg [Prunus pe... 105 6e-23 XP_011080923.1 PREDICTED: BTB/POZ domain-containing protein At1g... 104 9e-23 XP_012086845.1 PREDICTED: BTB/POZ domain-containing protein At1g... 104 1e-22 XP_006476518.1 PREDICTED: BTB/POZ domain-containing protein At1g... 104 2e-22 GAV76112.1 hypothetical protein CFOL_v3_19587 [Cephalotus follic... 104 2e-22 KDP25402.1 hypothetical protein JCGZ_20558 [Jatropha curcas] 104 2e-22 XP_009341340.1 PREDICTED: BTB/POZ domain-containing protein At1g... 103 2e-22 XP_002279382.2 PREDICTED: BTB/POZ domain-containing protein At1g... 103 2e-22 XP_010089067.1 BTB/POZ domain-containing protein [Morus notabili... 102 3e-22 XP_002531214.1 PREDICTED: BTB/POZ domain-containing protein At1g... 102 3e-22 XP_008238939.1 PREDICTED: BTB/POZ domain-containing protein At1g... 103 4e-22 XP_006439497.1 hypothetical protein CICLE_v10019226mg [Citrus cl... 103 4e-22 KDO76298.1 hypothetical protein CISIN_1g006210mg [Citrus sinensis] 103 4e-22 OAY59777.1 hypothetical protein MANES_01G058800 [Manihot esculenta] 103 4e-22 XP_010255266.1 PREDICTED: BTB/POZ domain-containing protein At1g... 103 4e-22 OMO58612.1 hypothetical protein COLO4_34505 [Corchorus olitorius] 102 5e-22 >XP_004300808.1 PREDICTED: BTB/POZ domain-containing protein At1g63850 [Fragaria vesca subsp. vesca] Length = 616 Score = 107 bits (266), Expect = 2e-23 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCE 159 EILLAWFNRFLNSGEDCPNIQRGF+VWWRR+FWRRNGE ERPR LRI AAT E Sbjct: 563 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRSFWRRNGEQERPRPLRITAATIE 615 >XP_010919095.1 PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis guineensis] Length = 637 Score = 105 bits (263), Expect = 4e-23 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWF RFLNSG+DCPNIQRGF+VWWRRAFWRRNGE E+P LRIAAA CE+S Sbjct: 583 EILLAWFERFLNSGDDCPNIQRGFEVWWRRAFWRRNGEPEQPPQLRIAAAVCENS 637 >XP_009363413.1 PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus x bretschneideri] Length = 651 Score = 105 bits (263), Expect = 5e-23 Identities = 47/55 (85%), Positives = 48/55 (87%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRN E ERPR LR AT EDS Sbjct: 597 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNDEQERPRPLRTTTATMEDS 651 >ONI07175.1 hypothetical protein PRUPE_5G104400 [Prunus persica] Length = 643 Score = 105 bits (262), Expect = 6e-23 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRNGE ER R LRI AT E+S Sbjct: 589 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQERSRPLRITTATIENS 643 >XP_007210316.1 hypothetical protein PRUPE_ppa002210mg [Prunus persica] Length = 700 Score = 105 bits (262), Expect = 6e-23 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRNGE ER R LRI AT E+S Sbjct: 646 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQERSRPLRITTATIENS 700 >XP_011080923.1 PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Sesamum indicum] Length = 532 Score = 104 bits (260), Expect = 9e-23 Identities = 45/55 (81%), Positives = 52/55 (94%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILL+WF+RFLN+G+DCPNIQRGF+VWWRRAFWRRNGE ERPRLLRI AA+ E+S Sbjct: 478 EILLSWFDRFLNAGDDCPNIQRGFEVWWRRAFWRRNGELERPRLLRIMAASIENS 532 >XP_012086845.1 PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Jatropha curcas] XP_012086846.1 PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Jatropha curcas] Length = 525 Score = 104 bits (259), Expect = 1e-22 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRNGE ER + LRI AT E+S Sbjct: 471 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQERSKPLRITTATIENS 525 >XP_006476518.1 PREDICTED: BTB/POZ domain-containing protein At1g63850 [Citrus sinensis] Length = 656 Score = 104 bits (259), Expect = 2e-22 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EIL+AWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRNGE E+ + LRIAAAT E+S Sbjct: 602 EILIAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQEQLQQLRIAAATIENS 656 >GAV76112.1 hypothetical protein CFOL_v3_19587 [Cephalotus follicularis] Length = 664 Score = 104 bits (259), Expect = 2e-22 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILL WFNRFLNSGE+CPNIQRGF++WWRRAFWRRNGE E+PR LRIA AT ++S Sbjct: 610 EILLGWFNRFLNSGEECPNIQRGFEIWWRRAFWRRNGEQEQPRQLRIATATTDNS 664 >KDP25402.1 hypothetical protein JCGZ_20558 [Jatropha curcas] Length = 665 Score = 104 bits (259), Expect = 2e-22 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRNGE ER + LRI AT E+S Sbjct: 611 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQERSKPLRITTATIENS 665 >XP_009341340.1 PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus x bretschneideri] Length = 653 Score = 103 bits (258), Expect = 2e-22 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFW+R G+ ERPR LRI AT E+S Sbjct: 599 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRTGDQERPRPLRITTATIENS 653 >XP_002279382.2 PREDICTED: BTB/POZ domain-containing protein At1g63850 [Vitis vinifera] Length = 667 Score = 103 bits (258), Expect = 2e-22 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWF+RFLNSGEDCPNIQRGF+VWWRRAFWRR+G++ERPR LRI AT E+S Sbjct: 613 EILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRHGKTERPRQLRITTATIENS 667 >XP_010089067.1 BTB/POZ domain-containing protein [Morus notabilis] EXB37314.1 BTB/POZ domain-containing protein [Morus notabilis] Length = 437 Score = 102 bits (255), Expect = 3e-22 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 +ILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRR+GE ER R LRI AT E+S Sbjct: 383 DILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQERTRSLRITTATIENS 437 >XP_002531214.1 PREDICTED: BTB/POZ domain-containing protein At1g63850 [Ricinus communis] EEF31191.1 protein binding protein, putative [Ricinus communis] Length = 474 Score = 102 bits (255), Expect = 3e-22 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF++WWRRAFWRR+GE ER R LRI AT E+S Sbjct: 420 EILLAWFNRFLNSGEDCPNIQRGFEIWWRRAFWRRSGEQERTRPLRIMTATIENS 474 >XP_008238939.1 PREDICTED: BTB/POZ domain-containing protein At1g63850 [Prunus mume] Length = 643 Score = 103 bits (256), Expect = 4e-22 Identities = 46/55 (83%), Positives = 48/55 (87%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRRNGE ER LRI AT E+S Sbjct: 589 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQERSPSLRITTATIENS 643 >XP_006439497.1 hypothetical protein CICLE_v10019226mg [Citrus clementina] ESR52737.1 hypothetical protein CICLE_v10019226mg [Citrus clementina] Length = 653 Score = 103 bits (256), Expect = 4e-22 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWR NGE E+ + LRIAAAT E+S Sbjct: 599 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRHNGEQEQLQQLRIAAATIENS 653 >KDO76298.1 hypothetical protein CISIN_1g006210mg [Citrus sinensis] Length = 656 Score = 103 bits (256), Expect = 4e-22 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 EILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWR NGE E+ + LRIAAAT E+S Sbjct: 602 EILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRHNGEQEQLQQLRIAAATIENS 656 >OAY59777.1 hypothetical protein MANES_01G058800 [Manihot esculenta] Length = 662 Score = 103 bits (256), Expect = 4e-22 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 +ILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRR+GE ER R LRI++AT E+S Sbjct: 608 DILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQERTRPLRISSATIENS 662 >XP_010255266.1 PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nelumbo nucifera] Length = 667 Score = 103 bits (256), Expect = 4e-22 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCED 162 EILLAWFNRFLN GEDCPNIQRGF+VWWRRAFWRRNGE ERP R+A A CE+ Sbjct: 613 EILLAWFNRFLNCGEDCPNIQRGFEVWWRRAFWRRNGEPERPPQFRVATAGCEN 666 >OMO58612.1 hypothetical protein COLO4_34505 [Corchorus olitorius] Length = 654 Score = 102 bits (255), Expect = 5e-22 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = +1 Query: 1 EILLAWFNRFLNSGEDCPNIQRGFQVWWRRAFWRRNGESERPRLLRIAAATCEDS 165 +ILLAWFNRFLNSGEDCPNIQRGF+VWWRRAFWRR+GE E PR L++ AAT E+S Sbjct: 600 DILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQELPRQLQVTAATIENS 654