BLASTX nr result
ID: Papaver32_contig00028051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00028051 (663 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF27214.1 conserved hypothetical protein [Ricinus communis] 63 1e-09 OAY74184.1 hypothetical protein ACMD2_14106 [Ananas comosus] 57 1e-07 >EEF27214.1 conserved hypothetical protein [Ricinus communis] Length = 84 Score = 62.8 bits (151), Expect = 1e-09 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -2 Query: 239 RFFRTSSLMMKVFSRACTTSPEYSQYIWRETIPPIEVRMGSGLFTSHQSARF 84 R F SS + RA T SPE SQYIWR+TIP IEV MGSG+FTS++SARF Sbjct: 32 RIFEKSSFLY----RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARF 79 >OAY74184.1 hypothetical protein ACMD2_14106 [Ananas comosus] Length = 63 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 182 SPEYSQYIWRETIPPIEVRMGSGLFTSHQSAR 87 SPE SQYIWR+TIP IEV MGSG+FTSH+SAR Sbjct: 2 SPEQSQYIWRKTIPHIEVGMGSGVFTSHRSAR 33