BLASTX nr result
ID: Papaver32_contig00027420
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00027420 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015902955.1 PREDICTED: auxin-induced protein 6B-like [Ziziphu... 56 6e-07 XP_015884808.1 PREDICTED: auxin-induced protein 6B [Ziziphus juj... 56 6e-07 XP_018818432.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 56 9e-07 XP_018807019.1 PREDICTED: auxin-induced protein 6B-like [Juglans... 56 9e-07 XP_013466175.1 SAUR-like auxin-responsive family protein [Medica... 55 2e-06 OAY22652.1 hypothetical protein MANES_18G015300 [Manihot esculenta] 54 6e-06 XP_008466498.1 PREDICTED: auxin-induced protein 6B [Cucumis melo] 53 9e-06 XP_011652445.1 PREDICTED: auxin-induced protein 6B-like [Cucumis... 53 9e-06 >XP_015902955.1 PREDICTED: auxin-induced protein 6B-like [Ziziphus jujuba] Length = 151 Score = 56.2 bits (134), Expect = 6e-07 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -1 Query: 516 RYCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 RYCHVG+ + DFWP+SRPLLH +EKSIW Sbjct: 122 RYCHVGIRSNLDFWPDSRPLLHGFAEKSIW 151 >XP_015884808.1 PREDICTED: auxin-induced protein 6B [Ziziphus jujuba] Length = 151 Score = 56.2 bits (134), Expect = 6e-07 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -1 Query: 516 RYCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 RYCHVG+ + DFWP+SRPLLH +EKSIW Sbjct: 122 RYCHVGIRSNLDFWPDSRPLLHGFAEKSIW 151 >XP_018818432.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 150 Score = 55.8 bits (133), Expect = 9e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -1 Query: 513 YCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 YCHVG+ +K DFW ESRPLLH L+EKSIW Sbjct: 122 YCHVGIRSKLDFWAESRPLLHGLTEKSIW 150 >XP_018807019.1 PREDICTED: auxin-induced protein 6B-like [Juglans regia] Length = 150 Score = 55.8 bits (133), Expect = 9e-07 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -1 Query: 513 YCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 YCHVG+ +K DFW ESRPLLH L+EKSIW Sbjct: 122 YCHVGIRSKLDFWAESRPLLHGLTEKSIW 150 >XP_013466175.1 SAUR-like auxin-responsive family protein [Medicago truncatula] KEH40216.1 SAUR-like auxin-responsive family protein [Medicago truncatula] Length = 146 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -1 Query: 516 RYCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 R CHVG+ DFWPESRPLLH LSEK+IW Sbjct: 117 RRCHVGIRTNVDFWPESRPLLHGLSEKTIW 146 >OAY22652.1 hypothetical protein MANES_18G015300 [Manihot esculenta] Length = 150 Score = 53.5 bits (127), Expect = 6e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -1 Query: 516 RYCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 RYCHVG+ +K DFW ESRPLLH ++K+IW Sbjct: 121 RYCHVGVRSKLDFWTESRPLLHGFADKTIW 150 >XP_008466498.1 PREDICTED: auxin-induced protein 6B [Cucumis melo] Length = 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -1 Query: 513 YCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 YCH+G+ D WPESRPLLH L+EKSIW Sbjct: 122 YCHIGIRTGLDLWPESRPLLHGLAEKSIW 150 >XP_011652445.1 PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] Length = 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -1 Query: 513 YCHVGLNAKFDFWPESRPLLHTLSEKSIW 427 YCH+G+ D WPESRPLLH L+EKSIW Sbjct: 122 YCHIGIRTGLDLWPESRPLLHGLAEKSIW 150