BLASTX nr result
ID: Papaver32_contig00026971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00026971 (879 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OEL20139.1 hypothetical protein BAE44_0018842 [Dichanthelium oli... 56 9e-06 >OEL20139.1 hypothetical protein BAE44_0018842 [Dichanthelium oligosanthes] Length = 194 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 3 YVGNLDPRVSERELEDEFRTYGVLRRKFCRPQNVFFH 113 YVGNLDPRV+ RELEDEFRT+GVLRR PQ+ + Sbjct: 5 YVGNLDPRVTARELEDEFRTFGVLRRSVLSPQDYLLY 41