BLASTX nr result
ID: Papaver32_contig00026465
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00026465 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010249887.1 PREDICTED: tudor domain-containing protein 3 [Nel... 57 1e-06 >XP_010249887.1 PREDICTED: tudor domain-containing protein 3 [Nelumbo nucifera] Length = 417 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = +2 Query: 320 VSLILETLIHKGWCFRNTEEIKSQIHNHISTVNNRVSADSIESELLLNLDLKIIG 484 + ++LE LI +GWCFR+ EE+K I +I+ S DS+ESE LLNLDLK IG Sbjct: 1 MEVVLEALIRRGWCFRDVEEVKGLIQINIALSGELGSVDSVESE-LLNLDLKSIG 54