BLASTX nr result
ID: Papaver32_contig00024760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00024760 (851 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010100620.1 putative 38.1 kDa protein [Morus notabilis] EXB83... 60 1e-06 >XP_010100620.1 putative 38.1 kDa protein [Morus notabilis] EXB83257.1 putative 38.1 kDa protein [Morus notabilis] Length = 342 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +3 Query: 3 PELIKWEMEASAARVGLWALPNPEMPCDWRKNNP 104 P+ +WE EA A RVGLWA PNPE P DWRKNNP Sbjct: 305 PQFARWEKEARAKRVGLWASPNPEKPWDWRKNNP 338