BLASTX nr result
ID: Papaver32_contig00024429
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00024429 (502 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMT16089.1 hypothetical protein F775_02621 [Aegilops tauschii] 57 8e-07 >EMT16089.1 hypothetical protein F775_02621 [Aegilops tauschii] Length = 254 Score = 57.4 bits (137), Expect = 8e-07 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 2/36 (5%) Frame = +2 Query: 209 GESSTKMGDRLGSPR--VSFLAYPNLFGTRGLEEKE 310 GESS +MGD LGSPR VS+LAYPNLFGT+GLEE+E Sbjct: 203 GESSARMGDLLGSPRERVSYLAYPNLFGTKGLEEEE 238