BLASTX nr result
ID: Papaver32_contig00023697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00023697 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002527484.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Rici... 86 3e-17 KDO57845.1 hypothetical protein CISIN_1g023376mg [Citrus sinensis] 86 3e-17 XP_006486949.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Citr... 86 3e-17 XP_006422860.1 hypothetical protein CICLE_v10028999mg [Citrus cl... 86 3e-17 XP_015942160.1 PREDICTED: RING-H2 finger protein ATL77-like [Ara... 84 5e-17 OAY39197.1 hypothetical protein MANES_10G074800 [Manihot esculenta] 84 7e-17 XP_010277125.1 PREDICTED: probable E3 ubiquitin-protein ligase R... 85 8e-17 XP_016177046.1 PREDICTED: E3 ubiquitin-protein ligase RNF181-lik... 84 1e-16 XP_019426571.1 PREDICTED: probable E3 ubiquitin-protein ligase R... 82 1e-15 XP_012093084.1 PREDICTED: probable E3 ubiquitin-protein ligase H... 82 2e-15 XP_010099077.1 Zinc/RING finger protein 3 [Morus notabilis] EXB7... 82 2e-15 XP_016539459.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Caps... 81 3e-15 XP_011030369.1 PREDICTED: uncharacterized protein LOC105129834 [... 81 3e-15 XP_006369739.1 hypothetical protein POPTR_0001s30420g [Populus t... 81 3e-15 XP_011001692.1 PREDICTED: uncharacterized protein LOC105108889 [... 81 3e-15 XP_019229281.1 PREDICTED: probable E3 ubiquitin-protein ligase R... 81 3e-15 XP_010271884.1 PREDICTED: probable E3 ubiquitin-protein ligase R... 81 4e-15 XP_015064228.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Sola... 80 8e-15 XP_010647940.1 PREDICTED: probable E3 ubiquitin-protein ligase R... 79 8e-15 XP_006346328.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 80 9e-15 >XP_002527484.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Ricinus communis] EEF34882.1 conserved hypothetical protein [Ricinus communis] Length = 282 Score = 86.3 bits (212), Expect = 3e-17 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD+LICLPC HRFH SCLDPWVR CGDCPYCR I Sbjct: 233 ICLESFKDGDKLICLPCNHRFHSSCLDPWVRTCGDCPYCRRDI 275 >KDO57845.1 hypothetical protein CISIN_1g023376mg [Citrus sinensis] Length = 283 Score = 86.3 bits (212), Expect = 3e-17 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD LICLPCKHRFH CLDPWVR CGDCPYCR I Sbjct: 233 ICLESFTDGDELICLPCKHRFHSDCLDPWVRSCGDCPYCRRNI 275 >XP_006486949.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Citrus sinensis] Length = 283 Score = 86.3 bits (212), Expect = 3e-17 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD LICLPCKHRFH CLDPWVR CGDCPYCR I Sbjct: 233 ICLESFTDGDELICLPCKHRFHSDCLDPWVRSCGDCPYCRRNI 275 >XP_006422860.1 hypothetical protein CICLE_v10028999mg [Citrus clementina] ESR36100.1 hypothetical protein CICLE_v10028999mg [Citrus clementina] Length = 283 Score = 86.3 bits (212), Expect = 3e-17 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD LICLPCKHRFH CLDPWVR CGDCPYCR I Sbjct: 233 ICLESFTDGDELICLPCKHRFHSDCLDPWVRSCGDCPYCRRNI 275 >XP_015942160.1 PREDICTED: RING-H2 finger protein ATL77-like [Arachis duranensis] Length = 211 Score = 84.3 bits (207), Expect = 5e-17 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD+LICLPC HRFH +CLDPWVR CGDCPYCR I Sbjct: 165 ICLESFVDGDQLICLPCHHRFHFACLDPWVRCCGDCPYCRRHI 207 >OAY39197.1 hypothetical protein MANES_10G074800 [Manihot esculenta] Length = 212 Score = 84.0 bits (206), Expect = 7e-17 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F + D+LICLPC+HRFH +CLDPWVR CGDCPYCR I Sbjct: 163 ICLESFKERDKLICLPCEHRFHFACLDPWVRTCGDCPYCRRDI 205 >XP_010277125.1 PREDICTED: probable E3 ubiquitin-protein ligase RHY1A isoform X1 [Nelumbo nucifera] XP_010277126.1 PREDICTED: probable E3 ubiquitin-protein ligase RHY1A isoform X1 [Nelumbo nucifera] Length = 280 Score = 85.1 bits (209), Expect = 8e-17 Identities = 38/57 (66%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI--GHHH----KPIN 364 ICLE+F GD LI LPC+HRFH +CLDPWV+ CGDCPYCRT I GHH KP+N Sbjct: 222 ICLERFQGGDWLISLPCEHRFHSACLDPWVQICGDCPYCRTAIVVGHHQMGIKKPLN 278 >XP_016177046.1 PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Arachis ipaensis] Length = 219 Score = 83.6 bits (205), Expect = 1e-16 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD+LICLPC HRFH +CLDPWVR CGDCPYCR I Sbjct: 173 ICLESFVDGDQLICLPCHHRFHSACLDPWVRCCGDCPYCRRHI 215 >XP_019426571.1 PREDICTED: probable E3 ubiquitin-protein ligase RHY1A [Lupinus angustifolius] OIV91129.1 hypothetical protein TanjilG_30351 [Lupinus angustifolius] Length = 261 Score = 81.6 bits (200), Expect = 1e-15 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F GD+LICLPC H+FH +CL+PWVR CGDCPYCR I Sbjct: 201 ICLESFTDGDKLICLPCGHKFHSACLNPWVRSCGDCPYCRRGI 243 >XP_012093084.1 PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Jatropha curcas] KDP44464.1 hypothetical protein JCGZ_16297 [Jatropha curcas] Length = 286 Score = 81.6 bits (200), Expect = 2e-15 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F +GD+L+ LPC+HRFH +CLDPWVR CGDCPYCR I Sbjct: 237 ICLESFKEGDKLVRLPCEHRFHAACLDPWVRTCGDCPYCRRDI 279 >XP_010099077.1 Zinc/RING finger protein 3 [Morus notabilis] EXB76666.1 Zinc/RING finger protein 3 [Morus notabilis] Length = 304 Score = 81.6 bits (200), Expect = 2e-15 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F QGDRLICLPC+HRFH CLDPWVR GDCPYCR I Sbjct: 245 ICLESFFQGDRLICLPCEHRFHAVCLDPWVRIRGDCPYCRRVI 287 >XP_016539459.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Capsicum annuum] Length = 281 Score = 80.9 bits (198), Expect = 3e-15 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICL+ F +GD+L+CLPC HRFH CL+PWVR CGDCPYCR I Sbjct: 228 ICLDAFLEGDKLVCLPCGHRFHPCCLEPWVRTCGDCPYCRAAI 270 >XP_011030369.1 PREDICTED: uncharacterized protein LOC105129834 [Populus euphratica] Length = 283 Score = 80.9 bits (198), Expect = 3e-15 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F++GD LI LPC HRFH +CLDPWVR CGDCPYCR I Sbjct: 236 ICLESFSEGDELIRLPCDHRFHSACLDPWVRTCGDCPYCRRDI 278 >XP_006369739.1 hypothetical protein POPTR_0001s30420g [Populus trichocarpa] ERP66308.1 hypothetical protein POPTR_0001s30420g [Populus trichocarpa] Length = 283 Score = 80.9 bits (198), Expect = 3e-15 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F++GD LI LPC HRFH +CLDPWVR CGDCPYCR I Sbjct: 236 ICLESFSEGDELIRLPCDHRFHSACLDPWVRTCGDCPYCRRDI 278 >XP_011001692.1 PREDICTED: uncharacterized protein LOC105108889 [Populus euphratica] Length = 284 Score = 80.9 bits (198), Expect = 3e-15 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICLE F +GD LI LPC+HRFH +CLDPWVR CGDCPYCR + Sbjct: 237 ICLESFTEGDELIRLPCEHRFHSACLDPWVRTCGDCPYCRRDV 279 >XP_019229281.1 PREDICTED: probable E3 ubiquitin-protein ligase RHY1A [Nicotiana attenuata] OIT30198.1 putative e3 ubiquitin-protein ligase rhy1a [Nicotiana attenuata] Length = 287 Score = 80.9 bits (198), Expect = 3e-15 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICL+ F +GD+LICLPC HRFH CL+PWVR CGDCPYCR I Sbjct: 234 ICLDAFLEGDKLICLPCGHRFHPCCLEPWVRSCGDCPYCRGAI 276 >XP_010271884.1 PREDICTED: probable E3 ubiquitin-protein ligase RHY1A [Nelumbo nucifera] Length = 295 Score = 80.9 bits (198), Expect = 4e-15 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYC-RTPIGHHHKPIN*VPSS 349 ICLE+F +G++LICLPC HRFH +CL PWV+ CGDCPYC R + +HK N PS+ Sbjct: 237 ICLERFQEGNQLICLPCDHRFHSACLGPWVQICGDCPYCRRAVVVDYHKMRNKKPSN 293 >XP_015064228.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Solanum pennellii] XP_015064235.1 PREDICTED: E3 ubiquitin-protein ligase RLIM [Solanum pennellii] Length = 276 Score = 79.7 bits (195), Expect = 8e-15 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICL+ F +GD+L+CLPC HR+H CL+PWVR CGDCPYCR I Sbjct: 232 ICLDAFLEGDKLVCLPCGHRYHPCCLEPWVRTCGDCPYCRAAI 274 >XP_010647940.1 PREDICTED: probable E3 ubiquitin-protein ligase RHY1A isoform X2 [Vitis vinifera] Length = 257 Score = 79.3 bits (194), Expect = 8e-15 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICL+ + +GD+L CLPC H+FH +CLDPWVR CGDCPYCR+ I Sbjct: 211 ICLDGYREGDKLTCLPCGHKFHSACLDPWVRTCGDCPYCRSVI 253 >XP_006346328.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Solanum tuberosum] XP_015163740.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Solanum tuberosum] Length = 288 Score = 79.7 bits (195), Expect = 9e-15 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 516 ICLEKFAQGDRLICLPCKHRFHLSCLDPWVRKCGDCPYCRTPI 388 ICL+ F +GD+L+CLPC HR+H CL+PWVR CGDCPYCR I Sbjct: 231 ICLDAFLEGDKLVCLPCGHRYHPCCLEPWVRTCGDCPYCRAAI 273