BLASTX nr result
ID: Papaver32_contig00021895
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00021895 (929 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOR36040.1 hypothetical protein AM228_14965 [Planktothricoides s... 55 4e-06 >KOR36040.1 hypothetical protein AM228_14965 [Planktothricoides sp. SR001] Length = 94 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/55 (47%), Positives = 32/55 (58%) Frame = +1 Query: 148 MVVRLWLFFDGWSSMVVRLWLFFDGRSPMVARLWLIFNGRSSMVARLWLFFDVWS 312 +V+R WLF GWS +V R WL G S +V R WL+ G S +V R WL WS Sbjct: 9 IVIRYWLFVIGWSLLVGRYWLVVIGWSLLVGRYWLVVIGWSLLVGRYWLVVIGWS 63