BLASTX nr result
ID: Papaver32_contig00021709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00021709 (562 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO93572.1 hypothetical protein COLO4_16840 [Corchorus olitorius] 67 5e-10 AFK44336.1 unknown [Lotus japonicus] 65 7e-10 XP_016549020.1 PREDICTED: uncharacterized protein LOC107848797 [... 65 8e-10 XP_017645144.1 PREDICTED: putative F-box protein At1g53370 [Goss... 64 1e-09 KCW62667.1 hypothetical protein EUGRSUZ_G00214 [Eucalyptus grandis] 66 2e-09 XP_013448641.1 F-box protein interaction domain protein [Medicag... 66 2e-09 XP_018732544.1 PREDICTED: F-box protein DOR [Eucalyptus grandis] 66 3e-09 XP_013448621.1 F-box protein interaction domain protein [Medicag... 65 3e-09 XP_013441861.1 F-box protein interaction domain protein [Medicag... 65 6e-09 OMO90482.1 hypothetical protein COLO4_19144 [Corchorus olitorius] 64 1e-08 XP_003601050.2 F-box protein interaction domain protein [Medicag... 64 1e-08 BAT95973.1 hypothetical protein VIGAN_08283000 [Vigna angularis ... 61 2e-08 XP_016552584.1 PREDICTED: F-box only protein 8-like [Capsicum an... 61 2e-08 XP_010650455.1 PREDICTED: F-box protein CPR30 isoform X1 [Vitis ... 63 2e-08 XP_013459363.1 F-box protein interaction domain protein [Medicag... 63 2e-08 CBI39148.3 unnamed protein product, partial [Vitis vinifera] 63 2e-08 XP_015874887.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 63 3e-08 XP_002299005.1 F-box family protein [Populus trichocarpa] EEE838... 63 3e-08 XP_018732545.1 PREDICTED: putative F-box protein At5g42430 [Euca... 62 4e-08 XP_011012382.1 PREDICTED: putative F-box protein At1g32420 [Popu... 62 4e-08 >OMO93572.1 hypothetical protein COLO4_16840 [Corchorus olitorius] Length = 322 Score = 67.4 bits (163), Expect = 5e-10 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = +2 Query: 341 DSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKH 484 D V EILSRLPVKSLLRFKCVCK WR LI EDP FI LH+NQ +K+ Sbjct: 14 DQLPVEEILSRLPVKSLLRFKCVCKAWRILI-EDPTFIALHVNQFEKN 60 >AFK44336.1 unknown [Lotus japonicus] Length = 193 Score = 65.5 bits (158), Expect = 7e-10 Identities = 37/70 (52%), Positives = 46/70 (65%) Frame = +2 Query: 272 SHLTEANSTIPLNSTAASSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYF 451 SHL ++ N A ++F D +V EILSRLPVKSLL+F+CVCK W LI DPYF Sbjct: 46 SHLKQSQQ----NQAMAVATFLPDELVV-EILSRLPVKSLLKFRCVCKSWMLLI-SDPYF 99 Query: 452 IDLHLNQSKK 481 I HL+ SK+ Sbjct: 100 IKKHLHLSKQ 109 >XP_016549020.1 PREDICTED: uncharacterized protein LOC107848797 [Capsicum annuum] Length = 166 Score = 64.7 bits (156), Expect = 8e-10 Identities = 37/79 (46%), Positives = 48/79 (60%), Gaps = 3/79 (3%) Frame = +2 Query: 323 SSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKH---PKI 493 ++ H + IV +ILSRLPV+SLLRFKCV K W LI E PYF HL +K + PKI Sbjct: 57 ATGIHFNEEIVVDILSRLPVRSLLRFKCVSKIWMALISE-PYFTMKHLKLAKNNQNSPKI 115 Query: 494 LFIVPILSERPSLFLQRNW 550 LF+ + + S +L W Sbjct: 116 LFLKDMFTSHLSSWLLYRW 134 >XP_017645144.1 PREDICTED: putative F-box protein At1g53370 [Gossypium arboreum] Length = 136 Score = 63.5 bits (153), Expect = 1e-09 Identities = 43/90 (47%), Positives = 49/90 (54%), Gaps = 13/90 (14%) Frame = +2 Query: 329 SFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKILFI-V 505 SF + +ILSRL VKSLLRFKCV K WR I EDP FI +HLN K L I V Sbjct: 10 SFQVPDDVEIDILSRLSVKSLLRFKCVKKSWRNFI-EDPVFIAMHLNYYDSWIKQLTIEV 68 Query: 506 PILSER------------PSLFLQRNWYGR 559 PIL +R L + R+WYGR Sbjct: 69 PILEDRLMFQPVMSFENNVELLVLRDWYGR 98 >KCW62667.1 hypothetical protein EUGRSUZ_G00214 [Eucalyptus grandis] Length = 379 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +2 Query: 350 IVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKIL 496 ++ EIL RLPVKSL +F CV RWRFLI DPYFIDLHL S PK+L Sbjct: 7 LLIEILKRLPVKSLCQFTCVSTRWRFLI-SDPYFIDLHLTHSATRPKLL 54 >XP_013448641.1 F-box protein interaction domain protein [Medicago truncatula] KEH22668.1 F-box protein interaction domain protein [Medicago truncatula] Length = 418 Score = 65.9 bits (159), Expect = 2e-09 Identities = 36/83 (43%), Positives = 51/83 (61%) Frame = +2 Query: 287 ANSTIPLNSTAASSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHL 466 +NS P ++ A +S D IV +ILSRLPVK+L++FKCVCK W+ LI DP F LHL Sbjct: 2 SNSDPPQSNGGAPTSLLLDELIV-DILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHL 60 Query: 467 NQSKKHPKILFIVPILSERPSLF 535 +S ++ + + S+ S F Sbjct: 61 QRSPRNTHLTLVSDRSSDDESNF 83 >XP_018732544.1 PREDICTED: F-box protein DOR [Eucalyptus grandis] Length = 530 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = +2 Query: 350 IVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKIL 496 ++ EIL RLPVKSL +F CV RWRFLI DPYFIDLHL S PK+L Sbjct: 7 LLIEILKRLPVKSLCQFTCVSTRWRFLI-SDPYFIDLHLTHSATRPKLL 54 >XP_013448621.1 F-box protein interaction domain protein [Medicago truncatula] KEH22648.1 F-box protein interaction domain protein [Medicago truncatula] Length = 422 Score = 65.5 bits (158), Expect = 3e-09 Identities = 33/76 (43%), Positives = 49/76 (64%) Frame = +2 Query: 302 PLNSTAASSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKK 481 P +S A +S D ++ +ILSRLPVK+L++FKCVCK W+ LI DP F LHL +S++ Sbjct: 11 PHSSGGAPTSILLDE-LITDILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSQR 69 Query: 482 HPKILFIVPILSERPS 529 + + + + SE S Sbjct: 70 NTHLALVSDLSSEDQS 85 >XP_013441861.1 F-box protein interaction domain protein [Medicago truncatula] KEH15886.1 F-box protein interaction domain protein [Medicago truncatula] Length = 430 Score = 64.7 bits (156), Expect = 6e-09 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = +2 Query: 302 PLNSTAASSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKK 481 P N A +S ++ EILSRLPVK+L++FKCVCK W+ LI DP F LHL +S + Sbjct: 11 PSNCCATTSLIVLLDELIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSPR 70 Query: 482 HPKIL 496 + +L Sbjct: 71 NTHLL 75 >OMO90482.1 hypothetical protein COLO4_19144 [Corchorus olitorius] Length = 357 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +2 Query: 359 EILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKILFI 502 EILSRLPVKSLLRFKCVCK WR LI E P FI LHLN+ +K+ F+ Sbjct: 18 EILSRLPVKSLLRFKCVCKSWRILI-EGPTFIALHLNRFEKNNDSRFL 64 >XP_003601050.2 F-box protein interaction domain protein [Medicago truncatula] AES71301.2 F-box protein interaction domain protein [Medicago truncatula] Length = 419 Score = 63.5 bits (153), Expect = 1e-08 Identities = 35/74 (47%), Positives = 49/74 (66%) Frame = +2 Query: 302 PLNSTAASSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKK 481 P ++ A +S D IV EILSRLPVK+L++FKCVCK W+ LI +DP F HL++S + Sbjct: 8 PHSNFGAPTSLLLDELIV-EILSRLPVKTLMQFKCVCKSWKTLISDDPVFAKFHLHRSPR 66 Query: 482 HPKILFIVPILSER 523 + + ILS+R Sbjct: 67 NTHL----AILSDR 76 >BAT95973.1 hypothetical protein VIGAN_08283000 [Vigna angularis var. angularis] Length = 170 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +2 Query: 350 IVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKILFI 502 ++ EILS LPV SL+RF+CV K W+FLI DPY + LHL +S ++P+IL + Sbjct: 13 LILEILSWLPVTSLMRFRCVSKTWKFLI-SDPYLVKLHLERSFRNPQILLL 62 >XP_016552584.1 PREDICTED: F-box only protein 8-like [Capsicum annuum] Length = 155 Score = 60.8 bits (146), Expect = 2e-08 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = +2 Query: 323 SSSFHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKH---PKI 493 ++ H + IV +ILSRLPV+SLLRFKCV K W LI E PYF HL +K + PKI Sbjct: 28 ATGIHFNEEIVVDILSRLPVRSLLRFKCVSKIWMALISE-PYFTMKHLKLAKNNQNSPKI 86 Query: 494 LFI 502 LF+ Sbjct: 87 LFL 89 >XP_010650455.1 PREDICTED: F-box protein CPR30 isoform X1 [Vitis vinifera] Length = 357 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +2 Query: 350 IVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKILFIVP 508 I+ +ILSRLPVKSLLRF+CVCK W LI P F++ HL Q K P I +VP Sbjct: 8 IMVDILSRLPVKSLLRFRCVCKAWCTLISH-PQFVETHLRQQHKRPVIGLVVP 59 >XP_013459363.1 F-box protein interaction domain protein [Medicago truncatula] KEH33394.1 F-box protein interaction domain protein [Medicago truncatula] Length = 466 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +2 Query: 350 IVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKIL 496 ++ EILSRLPVK+L++FKCVCK W+ LI DP F LHL +S ++ +L Sbjct: 27 LIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLRRSPRNTHLL 75 >CBI39148.3 unnamed protein product, partial [Vitis vinifera] Length = 711 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = +2 Query: 350 IVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHPKILFIVP 508 I+ +ILSRLPVKSLLRF+CVCK W LI P F++ HL Q K P I +VP Sbjct: 8 IMVDILSRLPVKSLLRFRCVCKAWCTLISH-PQFVETHLRQQHKRPVIGLVVP 59 >XP_015874887.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Ziziphus jujuba] XP_015874888.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Ziziphus jujuba] XP_015874889.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Ziziphus jujuba] Length = 396 Score = 62.8 bits (151), Expect = 3e-08 Identities = 36/68 (52%), Positives = 42/68 (61%), Gaps = 2/68 (2%) Frame = +2 Query: 359 EILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLN--QSKKHPKILFIVPILSERPSL 532 EIL+RLPV SLLRFKCVCK WR LI P+FI+ HL S +P +LFI I Sbjct: 24 EILARLPVISLLRFKCVCKSWRSLI-SSPFFIEKHLQVCNSINNPNLLFITKICD----- 77 Query: 533 FLQRNWYG 556 + NWYG Sbjct: 78 --RVNWYG 83 >XP_002299005.1 F-box family protein [Populus trichocarpa] EEE83810.1 F-box family protein [Populus trichocarpa] Length = 412 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +2 Query: 332 FHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHP 487 +H IV EIL++LP KSL+RF+CVCK W LI DP+F+ LH NQS P Sbjct: 31 YHIPQDIVAEILAKLPAKSLMRFRCVCKTWSSLI-RDPFFVKLHQNQSLNKP 81 >XP_018732545.1 PREDICTED: putative F-box protein At5g42430 [Eucalyptus grandis] Length = 386 Score = 62.4 bits (150), Expect = 4e-08 Identities = 36/72 (50%), Positives = 43/72 (59%), Gaps = 5/72 (6%) Frame = +2 Query: 296 TIPLNSTAASSSFHDDSAIV-----CEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDL 460 T + + A ++ H DS I+ EIL RLPVKSL +F CV RW LI DPYFIDL Sbjct: 11 TFDVAAIVAVAAKHLDSMIIPEDLLIEILKRLPVKSLCQFTCVSTRWSSLI-SDPYFIDL 69 Query: 461 HLNQSKKHPKIL 496 HL S PK+L Sbjct: 70 HLTHSATRPKLL 81 >XP_011012382.1 PREDICTED: putative F-box protein At1g32420 [Populus euphratica] Length = 413 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +2 Query: 332 FHDDSAIVCEILSRLPVKSLLRFKCVCKRWRFLIEEDPYFIDLHLNQSKKHP 487 +H IV E+L++LP KSL+RF+CVCK W LI DP+F+ LH NQS P Sbjct: 31 YHIPQDIVAEVLAKLPAKSLMRFRCVCKTWSSLI-RDPFFVKLHQNQSLNKP 81