BLASTX nr result
ID: Papaver32_contig00020211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00020211 (735 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_008964092.1 ribosomal protein S7 [Ajuga reptans] AHA84951.1 r... 239 2e-77 YP_358630.1 ribosomal protein S7 [Phalaenopsis aphrodite subsp. ... 239 2e-77 YP_319809.1 ribosomal protein S7 [Acorus calamus] YP_319822.1 ri... 239 2e-77 AAS65782.1 ribosomal protein S7 (chloroplast) [Petermannia cirro... 239 2e-77 AAS65744.1 ribosomal protein S7 (chloroplast) [Alstroemeria aure... 239 2e-77 YP_006666076.1 ribosomal protein S7 (chloroplast) [Capsicum annu... 238 4e-77 AFG25696.1 ribosomal protein S7, partial (plastid) [Iris virginica] 238 4e-77 AAS65759.1 ribosomal protein S7 (chloroplast) [Tripladenia cunni... 238 4e-77 NP_001238194.1 uncharacterized protein LOC100306140 [Glycine max... 239 6e-77 YP_009154997.1 ribosomal protein S7 (chloroplast) [Gentiana stra... 238 6e-77 YP_009136524.1 ribosomal protein S7 (chloroplast) [Prunus padus]... 238 6e-77 YP_009186078.1 ribosomal protein S7 (chloroplast) [Gynochthodes ... 238 6e-77 YP_009059565.1 ribosomal protein S7 [Iris gatesii] YP_009059578.... 238 6e-77 AKZ24099.1 ribosomal protein S7 (plastid) [Monarda fistulosa var... 238 9e-77 YP_009092812.1 ribosomal protein S7 [Bomarea edulis] YP_00909282... 238 9e-77 YP_001595553.1 ribosomal protein S7 [Lemna minor] YP_001595568.1... 238 9e-77 YP_004021710.1 ribosomal protein S7 [Prunus persica] YP_00402172... 238 9e-77 YP_001004230.1 ribosomal protein S7 [Ranunculus macranthus] YP_0... 238 9e-77 Q6EM87.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 237 1e-76 Q9GFN2.1 RecName: Full=30S ribosomal protein S7, chloroplastic A... 237 1e-76 >YP_008964092.1 ribosomal protein S7 [Ajuga reptans] AHA84951.1 ribosomal protein S7 (plastid) [Ajuga reptans] Length = 155 Score = 239 bits (611), Expect = 2e-77 Identities = 117/151 (77%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAANGSGDA+RKKEETHKMAEANRAFA Sbjct: 122 SELVDAANGSGDAIRKKEETHKMAEANRAFA 152 >YP_358630.1 ribosomal protein S7 [Phalaenopsis aphrodite subsp. formosana] YP_358644.1 ribosomal protein S7 [Phalaenopsis aphrodite subsp. formosana] YP_006073310.1 ribosomal protein S7 (chloroplast) [Phalaenopsis equestris] YP_006073315.1 ribosomal protein S7 (chloroplast) [Phalaenopsis equestris] YP_009107603.1 ribosomal protein S7 (chloroplast) [Phalaenopsis hybrid cultivar] YP_009107609.1 ribosomal protein S7 (chloroplast) [Phalaenopsis hybrid cultivar] Q3BAH4.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAW82544.1 ribosomal protein S7 (chloroplast) [Phalaenopsis aphrodite subsp. formosana] AAW82549.1 ribosomal protein S7 (chloroplast) [Phalaenopsis aphrodite subsp. formosana] AEB96327.1 ribosomal protein S7 (chloroplast) [Phalaenopsis equestris] AEB96329.1 ribosomal protein S7 (chloroplast) [Phalaenopsis equestris] AIU44814.1 ribosomal protein S7 (chloroplast) [Phalaenopsis hybrid cultivar] AIU44820.1 ribosomal protein S7 (chloroplast) [Phalaenopsis hybrid cultivar] Length = 155 Score = 239 bits (610), Expect = 2e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILKNGKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKNGKKSLAYQIIYRAVKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++MD +LS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMDFRLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >YP_319809.1 ribosomal protein S7 [Acorus calamus] YP_319822.1 ribosomal protein S7 [Acorus calamus] YP_001586227.1 ribosomal protein S7 [Acorus americanus] YP_001586240.1 ribosomal protein S7 [Acorus americanus] YP_009117720.1 ribosomal protein S7 (plastid) [Acorus gramineus] YP_009117733.1 ribosomal protein S7 (plastid) [Acorus gramineus] Q9GFN5.1 RecName: Full=30S ribosomal protein S7, chloroplastic A9LYE6.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAG26092.1 ribosomal protein S7 (chloroplast) [Acorus calamus] AAZ03883.1 ribosomal protein S7, partial (chloroplast) [Acorus americanus] CAI53840.1 ribosomal protein S7 (plastid) [Acorus calamus] CAI53853.1 ribosomal protein S7 (plastid) [Acorus calamus] ABX38789.1 ribosomal protein S7 (chloroplast) [Acorus americanus] ABX38802.1 ribosomal protein S7 (chloroplast) [Acorus americanus] AEX01249.1 ribosomal protein S7 (plastid) [Acorus gramineus] AJE71262.1 ribosomal protein S7 (plastid) [Acorus gramineus] AJE71275.1 ribosomal protein S7 (plastid) [Acorus gramineus] Length = 155 Score = 239 bits (610), Expect = 2e-77 Identities = 118/151 (78%), Positives = 134/151 (88%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRALKKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VKSRRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKSRRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETHKMAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHKMAEANRAFA 152 >AAS65782.1 ribosomal protein S7 (chloroplast) [Petermannia cirrosa] ANO45679.1 ribosomal protein S7 (chloroplast) [Petermannia cirrosa] Length = 155 Score = 239 bits (610), Expect = 2e-77 Identities = 117/151 (77%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRALKKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLLRASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >AAS65744.1 ribosomal protein S7 (chloroplast) [Alstroemeria aurea] AGQ55717.1 ribosomal protein S7 (chloroplast) [Alstroemeria aurea] AGQ55729.1 ribosomal protein S7 (chloroplast) [Alstroemeria aurea] ANO44544.1 ribosomal protein S7 (chloroplast) [Alstroemeria longistaminea] ANO44667.1 ribosomal protein S7 (chloroplast) [Bomarea sp. 878] ANO44972.1 ribosomal protein S7 (chloroplast) [Uvularia grandiflora] ANO45030.1 ribosomal protein S7 (chloroplast) [Uvularia sessiliflora] ANO45202.1 ribosomal protein S7 (chloroplast) [Drymophila moorei] ANO45496.1 ribosomal protein S7 (chloroplast) [Burchardia umbellata] Length = 155 Score = 239 bits (610), Expect = 2e-77 Identities = 117/151 (77%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRALKKIQQKT+TNPL V Sbjct: 2 SRRGTAKEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLLRASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >YP_006666076.1 ribosomal protein S7 (chloroplast) [Capsicum annuum] YP_006666089.1 ribosomal protein S7 (chloroplast) [Capsicum annuum] YP_009122908.1 ribosomal protein S7 (chloroplast) [Capsicum lycianthoides] YP_009122921.1 ribosomal protein S7 (chloroplast) [Capsicum lycianthoides] YP_009169713.1 ribosomal protein S7 (chloroplast) [Capsicum frutescens] YP_009169727.1 ribosomal protein S7 (chloroplast) [Capsicum frutescens] YP_009252637.1 ribosomal protein S7 (chloroplast) [Iochroma lehmannii] YP_009252649.1 ribosomal protein S7 (chloroplast) [Iochroma lehmannii] YP_009262909.1 ribosomal protein S7 (chloroplast) [Capsicum chinense] YP_009262922.1 ribosomal protein S7 (chloroplast) [Capsicum chinense] YP_009344296.1 ribosomal protein S7 (chloroplast) [Capsicum eximium] YP_009344310.1 ribosomal protein S7 (chloroplast) [Capsicum eximium] YP_009344035.1 ribosomal protein S7 (chloroplast) [Capsicum galapagoense] YP_009344049.1 ribosomal protein S7 (chloroplast) [Capsicum galapagoense] YP_009344122.1 ribosomal protein S7 (chloroplast) [Capsicum chacoense] YP_009344136.1 ribosomal protein S7 (chloroplast) [Capsicum chacoense] YP_009344209.1 ribosomal protein S7 (chloroplast) [Capsicum tovarii] YP_009344223.1 ribosomal protein S7 (chloroplast) [Capsicum tovarii] AFP90822.1 ribosomal protein S7 (chloroplast) [Capsicum annuum] AFP90835.1 ribosomal protein S7 (chloroplast) [Capsicum annuum] AIA77006.1 ribosomal protein S7 (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum] AIA77020.1 ribosomal protein S7 (chloroplast) (chloroplast) [Capsicum annuum var. glabriusculum] AJK90791.1 ribosomal protein S7 (chloroplast) [Capsicum lycianthoides] AJK90804.1 ribosomal protein S7 (chloroplast) [Capsicum lycianthoides] ALD50148.1 ribosomal protein S7 (chloroplast) [Capsicum annuum var. glabriusculum] ALD50162.1 ribosomal protein S7 (chloroplast) [Capsicum annuum var. glabriusculum] ALD50234.1 ribosomal protein S7 (chloroplast) [Capsicum frutescens] ALD50248.1 ribosomal protein S7 (chloroplast) [Capsicum frutescens] ALD50320.1 ribosomal protein S7 (chloroplast) [Capsicum annuum var. annuum] ALD50334.1 ribosomal protein S7 (chloroplast) [Capsicum annuum var. annuum] ALD50406.1 ribosomal protein S7 (chloroplast) [Capsicum baccatum var. baccatum] ALD50420.1 ribosomal protein S7 (chloroplast) [Capsicum baccatum var. baccatum] ANA56731.1 ribosomal protein S7 (chloroplast) [Iochroma lehmannii] ANA56744.1 ribosomal protein S7 (chloroplast) [Iochroma lehmannii] ANJ04003.1 ribosomal protein S7 (chloroplast) [Capsicum chinense] ANJ04016.1 ribosomal protein S7 (chloroplast) [Capsicum chinense] APT41681.1 ribosomal protein S7 (chloroplast) [Capsicum galapagoense] APT41695.1 ribosomal protein S7 (chloroplast) [Capsicum galapagoense] APT41768.1 ribosomal protein S7 (chloroplast) [Capsicum chinense] APT41782.1 ribosomal protein S7 (chloroplast) [Capsicum chinense] APT41855.1 ribosomal protein S7 (chloroplast) [Capsicum chacoense] APT41869.1 ribosomal protein S7 (chloroplast) [Capsicum chacoense] APT41942.1 ribosomal protein S7 (chloroplast) [Capsicum tovarii] APT41956.1 ribosomal protein S7 (chloroplast) [Capsicum tovarii] APT42029.1 ribosomal protein S7 (chloroplast) [Capsicum eximium] APT42043.1 ribosomal protein S7 (chloroplast) [Capsicum eximium] Length = 155 Score = 238 bits (608), Expect = 4e-77 Identities = 117/151 (77%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+TVK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDITVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETHKMAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHKMAEANRAFA 152 >AFG25696.1 ribosomal protein S7, partial (plastid) [Iris virginica] Length = 155 Score = 238 bits (608), Expect = 4e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLLRASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >AAS65759.1 ribosomal protein S7 (chloroplast) [Tripladenia cunninghamii] Length = 155 Score = 238 bits (608), Expect = 4e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQI+YRALKKIQQKT+TNPL V Sbjct: 2 SRRGTAKEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRALKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLLRASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >NP_001238194.1 uncharacterized protein LOC100306140 [Glycine max] ACU14175.1 unknown [Glycine max] Length = 173 Score = 239 bits (609), Expect = 6e-77 Identities = 123/181 (67%), Positives = 144/181 (79%) Frame = +1 Query: 7 MINPSLNVSSPNIPPLVIKGSRRDTTNSVSSSKPWVNQNTGKADPVYRNRLVNLMVNRIL 186 MI + V IPP + SRR T + T K+DP+YRNRLVN++VNRIL Sbjct: 1 MILALIKVIKKRIPPFTLM-SRRGTAE----------EKTAKSDPIYRNRLVNMLVNRIL 49 Query: 187 KNGKKSLAYQIIYRALKKIQQKTDTNPLIVLREAIQGATPDVTVKSRRVGGSTHQVPIEV 366 K+GKKSLAYQIIYRA+KKIQQKT+TNPL VLR+AI+G TPD+ VK+RRVGGSTHQVP+E+ Sbjct: 50 KHGKKSLAYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPVEI 109 Query: 367 GYAQGKALAIRWLLRASRKRPGKSMDVKLSRELMDAANGSGDAVRKKEETHKMAEANRAF 546 G QGKALAIRWLL ASRKRPG++M KLS EL+DAA GSGDA+RKKEETH+MAEANRAF Sbjct: 110 GSTQGKALAIRWLLGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAF 169 Query: 547 A 549 A Sbjct: 170 A 170 >YP_009154997.1 ribosomal protein S7 (chloroplast) [Gentiana straminea] YP_009155010.1 ribosomal protein S7 (chloroplast) [Gentiana straminea] YP_009155082.1 ribosomal protein S7 (chloroplast) [Gentiana crassicaulis] YP_009155095.1 ribosomal protein S7 (chloroplast) [Gentiana crassicaulis] YP_009257041.1 ribosomal protein S7 (chloroplast) [Gentiana tibetica] YP_009257054.1 ribosomal protein S7 (chloroplast) [Gentiana tibetica] AID57370.1 ribosomal protein S7 (chloroplast) [Gentiana straminea] AID57383.1 ribosomal protein S7 (chloroplast) [Gentiana straminea] AID61180.1 ribosomal protein S7 (chloroplast) [Gentiana crassicaulis] AID61193.1 ribosomal protein S7 (chloroplast) [Gentiana crassicaulis] AKZ31663.1 ribosomal protein S7 (chloroplast) [Gentiana robusta] AKZ31676.1 ribosomal protein S7 (chloroplast) [Gentiana robusta] ANG07691.1 ribosomal protein S7 (chloroplast) [Gentiana tibetica] ANG07704.1 ribosomal protein S7 (chloroplast) [Gentiana tibetica] AOP04339.1 ribosomal protein S7 (chloroplast) [Gentiana lawrencei var. farreri] AOP04351.1 ribosomal protein S7 (chloroplast) [Gentiana lawrencei var. farreri] Length = 155 Score = 238 bits (607), Expect = 6e-77 Identities = 115/144 (79%), Positives = 134/144 (93%) Frame = +1 Query: 118 QNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIVLREAIQG 297 + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL VLR+AI+G Sbjct: 9 EKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSVLRQAIRG 68 Query: 298 ATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLSRELMDAA 477 TPD+TVK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M +KLS EL+DAA Sbjct: 69 VTPDITVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMALKLSSELVDAA 128 Query: 478 NGSGDAVRKKEETHKMAEANRAFA 549 GSGDA+RKKEETH+MAEANRAFA Sbjct: 129 KGSGDAIRKKEETHRMAEANRAFA 152 >YP_009136524.1 ribosomal protein S7 (chloroplast) [Prunus padus] YP_009136537.1 ribosomal protein S7 (chloroplast) [Prunus padus] AKC99730.1 ribosomal protein S7 (chloroplast) [Prunus padus] AKC99742.1 ribosomal protein S7 (chloroplast) [Prunus padus] ALR69195.1 ribosomal protein S7 (plastid) [Prunus hypoleuca] ALR69208.1 ribosomal protein S7 (plastid) [Prunus hypoleuca] AMC32674.1 ribosomal protein S7 (chloroplast) [Prunus virginiana] Length = 155 Score = 238 bits (607), Expect = 6e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRSTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMVFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAANGSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAANGSGDAIRKKEETHRMAEANRAFA 152 >YP_009186078.1 ribosomal protein S7 (chloroplast) [Gynochthodes nanlingensis] YP_009186093.1 ribosomal protein S7 (chloroplast) [Gynochthodes nanlingensis] AIW05225.1 ribosomal protein S7 (plastid) [Aganosma cymosa] AIW05238.1 ribosomal protein S7 (plastid) [Aganosma cymosa] AIW05395.1 ribosomal protein S7 (plastid) [Epigynum auritum] AIW05407.1 ribosomal protein S7 (plastid) [Epigynum auritum] ALO71398.1 ribosomal protein S7 (chloroplast) [Gynochthodes nanlingensis] ALO71414.1 ribosomal protein S7 (chloroplast) [Gynochthodes nanlingensis] Length = 155 Score = 238 bits (607), Expect = 6e-77 Identities = 116/142 (81%), Positives = 133/142 (93%) Frame = +1 Query: 124 TGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIVLREAIQGAT 303 T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL VLR+AI+G T Sbjct: 11 TAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSVLRQAIRGVT 70 Query: 304 PDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLSRELMDAANG 483 PD+TVK+RRVGGSTHQVPIE+G AQGKALAIRWLL ASRKRPG++M KLS EL+DAA G Sbjct: 71 PDITVKARRVGGSTHQVPIEIGSAQGKALAIRWLLAASRKRPGRNMAFKLSSELVDAAKG 130 Query: 484 SGDAVRKKEETHKMAEANRAFA 549 SGDA+RKKEETH+MAEANRAFA Sbjct: 131 SGDAIRKKEETHRMAEANRAFA 152 >YP_009059565.1 ribosomal protein S7 [Iris gatesii] YP_009059578.1 ribosomal protein S7 [Iris gatesii] YP_009229119.1 ribosomal protein S7 (chloroplast) [Iris sanguinea] YP_009229133.1 ribosomal protein S7 (chloroplast) [Iris sanguinea] AAN32048.1 ribosomal protein S7 (chloroplast) [Iris missouriensis] AEX94165.1 ribosomal protein S7 (chloroplast) [Iris tenax] AIN79039.1 ribosomal protein S7 (plastid) [Iris gatesii] AIN79040.1 ribosomal protein S7 (plastid) [Iris gatesii] ALS46383.1 ribosomal protein S7 (chloroplast) [Iris sanguinea] ALS46398.1 ribosomal protein S7 (chloroplast) [Iris sanguinea] Length = 155 Score = 238 bits (607), Expect = 6e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLLRASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >AKZ24099.1 ribosomal protein S7 (plastid) [Monarda fistulosa var. mollis] Length = 155 Score = 238 bits (606), Expect = 9e-77 Identities = 120/161 (74%), Positives = 137/161 (85%) Frame = +1 Query: 67 SRRDTTNSVSSSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQ 246 SRR TT + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQ Sbjct: 2 SRRGTTE----------EKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQ 51 Query: 247 QKTDTNPLIVLREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKR 426 QKT+TNPL VLR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKR Sbjct: 52 QKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKR 111 Query: 427 PGKSMDVKLSRELMDAANGSGDAVRKKEETHKMAEANRAFA 549 PG++M KLS EL+DAA GSGDA+RKKEETHKMAEANRAFA Sbjct: 112 PGRNMAFKLSSELVDAAKGSGDAIRKKEETHKMAEANRAFA 152 >YP_009092812.1 ribosomal protein S7 [Bomarea edulis] YP_009092825.1 ribosomal protein S7 [Bomarea edulis] AIR12644.1 ribosomal protein S7 (plastid) [Bomarea edulis] AIR12657.1 ribosomal protein S7 (plastid) [Bomarea edulis] Length = 155 Score = 238 bits (606), Expect = 9e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRALKKIQQKT+TNPL V Sbjct: 2 SRRGTAKEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLLRASRKRPG++M +LS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLRASRKRPGRNMAFQLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHRMAEANRAFA 152 >YP_001595553.1 ribosomal protein S7 [Lemna minor] YP_001595568.1 ribosomal protein S7 [Lemna minor] A9L9E1.1 RecName: Full=30S ribosomal protein S7, chloroplastic ABD48540.1 ribosomal protein S7 (chloroplast) [Lemna minor] ABD48555.1 ribosomal protein S7 (chloroplast) [Lemna minor] AEX01303.1 ribosomal protein S7 (plastid) [Lemna trisulca] Length = 155 Score = 238 bits (606), Expect = 9e-77 Identities = 117/151 (77%), Positives = 134/151 (88%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VKSRRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKSRRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETHKMAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHKMAEANRAFA 152 >YP_004021710.1 ribosomal protein S7 [Prunus persica] YP_004021723.1 ribosomal protein S7 [Prunus persica] YP_004286147.1 ribosomal protein S7 [Fragaria vesca subsp. vesca] YP_004286161.1 ribosomal protein S7 [Fragaria vesca subsp. vesca] YP_004842283.1 ribosomal protein S7 [Pyrus pyrifolia] YP_004842296.1 ribosomal protein S7 [Pyrus pyrifolia] YP_006883308.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] YP_006883381.1 ribosomal protein S7 [Fragaria mandshurica] YP_007025428.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] YP_007025442.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] YP_007025513.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] YP_007025527.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] YP_008082778.1 ribosomal protein S7 [Prinsepia utilis] YP_008082791.1 ribosomal protein S7 [Prinsepia utilis] YP_008965537.1 ribosomal protein S7 [Pyrus spinosa] YP_008965551.1 ribosomal protein S7 [Pyrus spinosa] YP_009020084.1 ribosomal protein S7 (plastid) [Prunus mume] YP_009020097.1 ribosomal protein S7 (plastid) [Prunus mume] YP_009024726.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] YP_009024740.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] YP_009040252.1 ribosomal protein S7 [Fragaria iinumae] YP_009040266.1 ribosomal protein S7 [Fragaria iinumae] YP_009136356.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] YP_009136369.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] YP_009136440.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] YP_009136453.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] YP_009266649.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] YP_009266663.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] YP_009295481.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] YP_009295467.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] YP_009326463.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] YP_009326479.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] ABG76915.1 ribosomal protein S7 (chloroplast) [Fragaria x ananassa] ABG76922.1 ribosomal protein S7 (chloroplast) [Prunus persica] ADO65020.1 ribosomal protein S7 (chloroplast) [Prunus persica] ADO65034.1 ribosomal protein S7 (chloroplast) [Prunus persica] ADY15396.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. vesca] ADY15411.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. vesca] BAK69427.1 ribosomal protein S7 (chloroplast) [Pyrus pyrifolia] BAK69441.1 ribosomal protein S7 (chloroplast) [Pyrus pyrifolia] AET62700.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] AET62714.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] AET62785.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] AET62799.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] AFC17687.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] AFC17760.1 ribosomal protein S7 (plastid) [Fragaria mandshurica] AFQ39463.1 ribosomal protein S7 (plastid) [Fragaria x ananassa subsp. cuneifolia] AFQ39472.1 ribosomal protein S7 (plastid) [Fragaria virginiana] AFQ39481.1 ribosomal protein S7 (plastid) [Fragaria bucharica] AFQ39490.1 ribosomal protein S7 (plastid) [Fragaria orientalis] AFQ39499.1 ribosomal protein S7 (plastid) [Fragaria viridis] AFQ39508.1 ribosomal protein S7 (plastid) [Fragaria nilgerrensis] AFQ39517.1 ribosomal protein S7 (plastid) [Fragaria chinensis] AFQ39526.1 ribosomal protein S7 (plastid) [Fragaria moupinensis] AFQ39535.1 ribosomal protein S7 (plastid) [Fragaria tibetica] AFQ39544.1 ribosomal protein S7 (plastid) [Fragaria corymbosa] AFQ39553.1 ribosomal protein S7 (plastid) [Fragaria gracilis] AFS89535.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] AGL94744.1 ribosomal protein S7 (plastid) [Prinsepia utilis] AGL94758.1 ribosomal protein S7 (plastid) [Prinsepia utilis] AGN71755.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] AGN71769.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] AGN71840.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] AGN71854.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] AGN71925.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] AGN71939.1 ribosomal protein S7 (plastid) [Fragaria vesca subsp. bracteata] AGN72010.1 ribosomal protein S7 (plastid) [Dasiphora fruticosa subsp. floribunda] AGN72024.1 ribosomal protein S7 (plastid) [Dasiphora fruticosa subsp. floribunda] AGN72095.1 ribosomal protein S7 (plastid) [Fragaria iinumae] AGN72109.1 ribosomal protein S7 (plastid) [Fragaria iinumae] AGN72180.1 ribosomal protein S7 (plastid) [Fragaria mandshurica] AGN72194.1 ribosomal protein S7 (plastid) [Fragaria mandshurica] CDI73609.1 ribosomal protein S7 (plastid) [Pyrus spinosa] CDI73624.1 ribosomal protein S7 (plastid) [Pyrus spinosa] AHF72039.1 30S ribosomal protein S7 (chloroplast) [Rosa odorata var. gigantea] AHF72040.1 30S ribosomal protein S7 (chloroplast) [Rosa odorata var. gigantea] AHK26918.1 ribosomal protein S7 (plastid) [Prunus mume] AHK26931.1 ribosomal protein S7 (plastid) [Prunus mume] AHN13581.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] AHN13595.1 ribosomal protein S7 (chloroplast) [Prunus kansuensis] AKC99561.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] AKC99573.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] AKC99646.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] AKC99659.1 ribosomal protein S7 (chloroplast) [Prunus maximowiczii] AKC99814.1 ribosomal protein S7 (chloroplast) [Prunus serrulata var. spontanea] AKC99827.1 ribosomal protein S7 (chloroplast) [Prunus serrulata var. spontanea] AKC99901.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] AKC99914.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] AKC99982.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] AKC99995.1 ribosomal protein S7 (chloroplast) [Prunus subhirtella var. subhirtella] AKI30893.1 ribosomal protein S7 (chloroplast) [Fragaria chiloensis] AKI30972.1 ribosomal protein S7 (chloroplast) [Fragaria mandshurica] AKI31049.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] AKI31127.1 ribosomal protein S7 (chloroplast) [Fragaria iinumae] AKI31170.1 ribosomal protein S7 (chloroplast) [Fragaria vesca subsp. bracteata] AKI31284.1 ribosomal protein S7 (chloroplast) [Fragaria virginiana] AKN00100.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] AKN00113.1 ribosomal protein S7 (chloroplast) [Prunus yedoensis] ANI86520.1 ribosomal protein S7 (chloroplast) [Chaenomeles speciosa] ANI86533.1 ribosomal protein S7 (chloroplast) [Chaenomeles speciosa] ANI86688.1 ribosomal protein S7 (chloroplast) [Chaenomeles sinensis] ANI86701.1 ribosomal protein S7 (chloroplast) [Chaenomeles sinensis] ANK79021.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] ANK79022.1 ribosomal protein S7 (chloroplast) [Prunus pseudocerasus] ANY93422.1 ribosomal protein S7 (chloroplast) [Hagenia abyssinica] ANY93444.1 ribosomal protein S7 (chloroplast) [Hagenia abyssinica] AOI20295.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] AOI20296.1 ribosomal protein S7 (chloroplast) [Malus prunifolia] APD28278.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] APD28294.1 30S ribosomal protein S7 (chloroplast) [Rosa roxburghii] AQK77939.1 ribosomal protein S7 (chloroplast) [Sorbus torminalis] AQK77952.1 ribosomal protein S7 (chloroplast) [Sorbus torminalis] AQR56739.1 ribosomal protein S7 (chloroplast) [Adenostoma fasciculatum] Length = 155 Score = 238 bits (606), Expect = 9e-77 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMVFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAANGSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELVDAANGSGDAIRKKEETHRMAEANRAFA 152 >YP_001004230.1 ribosomal protein S7 [Ranunculus macranthus] YP_001004243.1 ribosomal protein S7 [Ranunculus macranthus] YP_002836136.1 ribosomal protein S7 [Megaleranthis saniculifolia] YP_002836149.1 ribosomal protein S7 [Megaleranthis saniculifolia] YP_009114914.1 ribosomal protein S7 [Thalictrum coreanum] YP_009114926.1 ribosomal protein S7 [Thalictrum coreanum] YP_009243077.1 ribosomal protein S7 (chloroplast) [Aconitum chiisanense] YP_009243089.1 ribosomal protein S7 (chloroplast) [Aconitum chiisanense] YP_009271084.1 ribosomal protein S7 (chloroplast) [Aconitum carmichaelii] YP_009271097.1 ribosomal protein S7 (chloroplast) [Aconitum carmichaelii] YP_009308125.1 ribosomal protein S7 (chloroplast) [Aconitum austrokoreense] YP_009308137.1 ribosomal protein S7 (chloroplast) [Aconitum austrokoreense] YP_009308522.1 ribosomal protein S7 (chloroplast) [Aconitum ciliare] YP_009308534.1 ribosomal protein S7 (chloroplast) [Aconitum ciliare] YP_009308608.1 ribosomal protein S7 (chloroplast) [Aconitum coreanum] YP_009308620.1 ribosomal protein S7 (chloroplast) [Aconitum coreanum] YP_009308693.1 ribosomal protein S7 (chloroplast) [Aconitum kusnezoffii] YP_009308705.1 ribosomal protein S7 (chloroplast) [Aconitum kusnezoffii] YP_009308778.1 ribosomal protein S7 (chloroplast) [Aconitum monanthum] YP_009308790.1 ribosomal protein S7 (chloroplast) [Aconitum monanthum] YP_009312746.1 ribosomal protein S7 (chloroplast) [Ranunculus occidentalis] YP_009312760.1 ribosomal protein S7 (chloroplast) [Ranunculus occidentalis] YP_009317845.1 ribosomal protein S7 (chloroplast) [Trollius chinensis] YP_009317858.1 ribosomal protein S7 (chloroplast) [Trollius chinensis] AAN31964.1 ribosomal protein S7 (chloroplast) [Scheuchzeria palustris] AAZ03886.1 ribosomal protein S7, partial (chloroplast) [Ranunculus macranthus] ABC70800.1 ribosomal protein S7 (chloroplast) [Ranunculus macranthus] ABC70813.1 ribosomal protein S7 (chloroplast) [Ranunculus macranthus] ACO92061.1 ribosomal protein S7 (chloroplast) [Megaleranthis saniculifolia] ACO92074.1 ribosomal protein S7 (chloroplast) [Megaleranthis saniculifolia] AGN74023.1 ribosomal protein S7 (chloroplast) [Aconitum barbatum var. puberulum] AGN74038.1 ribosomal protein S7 (chloroplast) [Aconitum barbatum var. puberulum] AIX03562.1 ribosomal protein S7 (plastid) [Thalictrum coreanum] AIX03574.1 ribosomal protein S7 (plastid) [Thalictrum coreanum] AMQ99334.1 ribosomal protein S7 (chloroplast) [Aconitum chiisanense] AMQ99335.1 ribosomal protein S7 (chloroplast) [Aconitum chiisanense] ANJ04434.1 ribosomal protein S7 (chloroplast) [Aconitum kusnezoffii] ANJ04446.1 ribosomal protein S7 (chloroplast) [Aconitum kusnezoffii] ANJ04599.1 ribosomal protein S7 (chloroplast) [Aconitum barbatum var. puberulum] ANJ04614.1 ribosomal protein S7 (chloroplast) [Aconitum barbatum var. puberulum] ANU80265.1 ribosomal protein S7 (chloroplast) [Aconitum carmichaelii] ANU80266.1 ribosomal protein S7 (chloroplast) [Aconitum carmichaelii] ANV27800.1 ribosomal protein S7 (chloroplast) [Aconitum coreanum] ANV27814.1 ribosomal protein S7 (chloroplast) [Aconitum coreanum] AOS52919.1 ribosomal protein S7 (chloroplast) [Aconitum austrokoreense] AOS52920.1 ribosomal protein S7 (chloroplast) [Aconitum austrokoreense] AOS85782.1 ribosomal protein S7 (chloroplast) [Aconitum barbatum var. hispidum] AOS85783.1 ribosomal protein S7 (chloroplast) [Aconitum barbatum var. hispidum] AOS85868.1 ribosomal protein S7 (chloroplast) [Aconitum ciliare] AOS85869.1 ribosomal protein S7 (chloroplast) [Aconitum ciliare] AOS85953.1 ribosomal protein S7 (chloroplast) [Aconitum coreanum] AOS85954.1 ribosomal protein S7 (chloroplast) [Aconitum coreanum] AOS86039.1 ribosomal protein S7 (chloroplast) [Aconitum jaluense subsp. jaluense] AOS86040.1 ribosomal protein S7 (chloroplast) [Aconitum jaluense subsp. jaluense] AOS86124.1 ribosomal protein S7 (chloroplast) [Aconitum jaluense subsp. jaluense] AOS86125.1 ribosomal protein S7 (chloroplast) [Aconitum jaluense subsp. jaluense] AOS86209.1 ribosomal protein S7 (chloroplast) [Aconitum japonicum subsp. napiforme] AOS86210.1 ribosomal protein S7 (chloroplast) [Aconitum japonicum subsp. napiforme] AOS86294.1 ribosomal protein S7 (chloroplast) [Aconitum kusnezoffii] AOS86295.1 ribosomal protein S7 (chloroplast) [Aconitum kusnezoffii] AOS86379.1 ribosomal protein S7 (chloroplast) [Aconitum monanthum] AOS86380.1 ribosomal protein S7 (chloroplast) [Aconitum monanthum] AOV63623.1 ribosomal protein S7 (chloroplast) [Ranunculus occidentalis] AOV63637.1 ribosomal protein S7 (chloroplast) [Ranunculus occidentalis] AOW68938.1 ribosomal protein S7 (chloroplast) [Ranunculus austro-oreganus] AOW68951.1 ribosomal protein S7 (chloroplast) [Ranunculus austro-oreganus] AOY40663.1 ribosomal protein S7 (chloroplast) [Trollius chinensis] AOY40664.1 ribosomal protein S7 (chloroplast) [Trollius chinensis] Length = 155 Score = 238 bits (606), Expect = 9e-77 Identities = 117/151 (77%), Positives = 134/151 (88%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRALKKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRALKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETHKMAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHKMAEANRAFA 152 >Q6EM87.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAQ64554.1 ribosomal protein S7 (chloroplast) [Hydrangea macrophylla] ANN38977.1 ribosomal protein S7 (chloroplast) [Hydrangea serrata f. fertilis] ANN38992.1 ribosomal protein S7 (chloroplast) [Hydrangea serrata f. fertilis] Length = 155 Score = 237 bits (605), Expect = 1e-76 Identities = 116/151 (76%), Positives = 134/151 (88%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLAASRKRPGRNMAFKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 ELMDAA GSGDA+RKKEETH+MAEANRAFA Sbjct: 122 SELMDAAKGSGDAIRKKEETHRMAEANRAFA 152 >Q9GFN2.1 RecName: Full=30S ribosomal protein S7, chloroplastic AAG26095.1 ribosomal protein S7 (chloroplast) [Asarum canadense] Length = 155 Score = 237 bits (605), Expect = 1e-76 Identities = 116/151 (76%), Positives = 135/151 (89%) Frame = +1 Query: 97 SSKPWVNQNTGKADPVYRNRLVNLMVNRILKNGKKSLAYQIIYRALKKIQQKTDTNPLIV 276 S + + T K+DP+YRNRLVN++VNRILK+GKKSLAYQIIYRA+KKIQQKT+TNPL V Sbjct: 2 SRRGTAEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYRAVKKIQQKTETNPLSV 61 Query: 277 LREAIQGATPDVTVKSRRVGGSTHQVPIEVGYAQGKALAIRWLLRASRKRPGKSMDVKLS 456 LR+AI+G TPD+ VK+RRVGGSTHQVPIE+G QGKALAIRWLL ASRKRPG++M +KLS Sbjct: 62 LRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGASRKRPGRNMALKLS 121 Query: 457 RELMDAANGSGDAVRKKEETHKMAEANRAFA 549 EL+DAA GSGDA+RKKEETHKMAEANRAFA Sbjct: 122 SELVDAAKGSGDAIRKKEETHKMAEANRAFA 152