BLASTX nr result
ID: Papaver32_contig00019488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00019488 (1232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEE50475.1 hypothetical protein OsJ_30528 [Oryza sativa Japonica... 69 5e-09 EEC66477.1 hypothetical protein OsI_32563 [Oryza sativa Indica G... 69 5e-09 AAK52534.1 Putative U1 small nuclear ribonucleoprotein [Oryza sa... 69 5e-09 KDO79518.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] 69 5e-09 XP_010254879.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 68 9e-09 XP_008783465.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 68 9e-09 ABD23908.1 U1 small nuclear ribonucleoprotein 70K [Oryza sativa ... 68 1e-08 XP_015614284.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 68 1e-08 XP_006662143.2 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 68 1e-08 KDO79520.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] 68 1e-08 XP_003573746.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 68 1e-08 KZV16429.1 hypothetical protein F511_28608 [Dorcoceras hygrometr... 68 1e-08 XP_006425695.1 hypothetical protein CICLE_v10025502mg [Citrus cl... 68 1e-08 XP_006425696.1 hypothetical protein CICLE_v10025502mg [Citrus cl... 68 1e-08 XP_015890206.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 67 2e-08 XP_015890205.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 67 2e-08 XP_008812364.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 ... 65 2e-08 KQK89613.1 hypothetical protein SETIT_035381mg [Setaria italica] 66 3e-08 EMS64156.1 U1 small nuclear ribonucleoprotein 70 kDa [Triticum u... 67 3e-08 BAJ90924.1 predicted protein [Hordeum vulgare subsp. vulgare] 67 3e-08 >EEE50475.1 hypothetical protein OsJ_30528 [Oryza sativa Japonica Group] Length = 476 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 1118 VHLKVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 + L VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 177 IRLLVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 214 >EEC66477.1 hypothetical protein OsI_32563 [Oryza sativa Indica Group] Length = 485 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 1118 VHLKVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 + L VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 177 IRLLVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 214 >AAK52534.1 Putative U1 small nuclear ribonucleoprotein [Oryza sativa Japonica Group] Length = 491 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 1118 VHLKVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 + L VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 192 IRLLVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 229 >KDO79518.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] Length = 501 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 KVR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 187 KVRLVTDKETNKPRGYAFIEYMHTRDMKAAYKQAD 221 >XP_010254879.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Nelumbo nucifera] Length = 499 Score = 68.2 bits (165), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR IT KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 166 RVRLITDKETNKPRGYAFIEYMHTRDMKAAYKQAD 200 >XP_008783465.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Phoenix dactylifera] XP_008783466.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Phoenix dactylifera] Length = 512 Score = 68.2 bits (165), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR IT KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 165 RVRLITDKETNKPRGYAFIEYMHTRDMKTAYKQAD 199 >ABD23908.1 U1 small nuclear ribonucleoprotein 70K [Oryza sativa Japonica Group] Length = 463 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 167 RVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 201 >XP_015614284.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Oryza sativa Japonica Group] ABB46629.1 transposon protein, putative, CACTA, En/Spm sub-class, expressed [Oryza sativa Japonica Group] BAF25964.1 Os10g0115600 [Oryza sativa Japonica Group] BAT09658.1 Os10g0115600 [Oryza sativa Japonica Group] Length = 463 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 167 RVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 201 >XP_006662143.2 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Oryza brachyantha] Length = 465 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 160 RVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 194 >KDO79520.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] Length = 473 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 159 RVRLVTDKETNKPRGYAFIEYMHTRDMKAAYKQAD 193 >XP_003573746.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Brachypodium distachyon] KQJ96167.1 hypothetical protein BRADI_3g21360 [Brachypodium distachyon] Length = 475 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 167 RVRLVTDKETNKPRGYAFIEYMHTRDMKNAYKQAD 201 >KZV16429.1 hypothetical protein F511_28608 [Dorcoceras hygrometricum] Length = 477 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 166 RVRLVTNKETNKPRGYAFIEYMHTRDMKAAYKQAD 200 >XP_006425695.1 hypothetical protein CICLE_v10025502mg [Citrus clementina] ESR38935.1 hypothetical protein CICLE_v10025502mg [Citrus clementina] Length = 478 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 166 RVRLVTDKETNKPRGYAFIEYMHTRDMKAAYKQAD 200 >XP_006425696.1 hypothetical protein CICLE_v10025502mg [Citrus clementina] XP_006466779.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa [Citrus sinensis] ESR38936.1 hypothetical protein CICLE_v10025502mg [Citrus clementina] KDO79519.1 hypothetical protein CISIN_1g010771mg [Citrus sinensis] Length = 480 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T KETNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 166 RVRLVTDKETNKPRGYAFIEYMHTRDMKAAYKQAD 200 >XP_015890206.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa isoform X2 [Ziziphus jujuba] Length = 492 Score = 67.0 bits (162), Expect = 2e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 ++R +TAK++NKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 166 RIRLVTAKDSNKPRGYAFIEYMHTRDMKAAYKQAD 200 >XP_015890205.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa isoform X1 [Ziziphus jujuba] Length = 496 Score = 67.0 bits (162), Expect = 2e-08 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 ++R +TAK++NKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 166 RIRLVTAKDSNKPRGYAFIEYMHTRDMKAAYKQAD 200 >XP_008812364.1 PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Phoenix dactylifera] Length = 277 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR IT K TNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 195 RVRLITDKVTNKPRGYAFIEYMHTRDMKTAYKQAD 229 >KQK89613.1 hypothetical protein SETIT_035381mg [Setaria italica] Length = 360 Score = 66.2 bits (160), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 KVR +T K+T+KPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 35 KVRLVTEKDTSKPRGYAFIEYMHTRDMKNAYKQAD 69 >EMS64156.1 U1 small nuclear ribonucleoprotein 70 kDa [Triticum urartu] Length = 454 Score = 66.6 bits (161), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T K+TNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 145 RVRLVTDKDTNKPRGYAFIEYMHTRDMKNAYKQAD 179 >BAJ90924.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 473 Score = 66.6 bits (161), Expect = 3e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 1127 KVRTITAKETNKPRGYAFIEYMHTRDMKSAYKQAD 1231 +VR +T K+TNKPRGYAFIEYMHTRDMK+AYKQAD Sbjct: 167 RVRLVTDKDTNKPRGYAFIEYMHTRDMKNAYKQAD 201