BLASTX nr result
ID: Papaver32_contig00019306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00019306 (460 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW13474.1 hypothetical protein TanjilG_22265 [Lupinus angustifo... 101 1e-25 XP_003626131.1 low temperature and salt responsive family protei... 98 3e-24 XP_010694118.1 PREDICTED: hydrophobic protein RCI2B [Beta vulgar... 97 4e-24 XP_010674472.1 PREDICTED: hydrophobic protein RCI2B isoform X2 [... 97 6e-24 XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus caro... 97 8e-24 NP_187239.1 Low temperature and salt responsive protein family [... 96 1e-23 XP_019093489.1 PREDICTED: hydrophobic protein RCI2A [Camelina sa... 96 2e-23 XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus pe... 97 2e-23 XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume... 95 3e-23 XP_009134854.1 PREDICTED: hydrophobic protein RCI2A-like [Brassi... 95 5e-23 XP_009124956.1 PREDICTED: hydrophobic protein RCI2B [Brassica ra... 94 7e-23 XP_019093512.1 PREDICTED: hydrophobic protein RCI2B-like [Cameli... 94 9e-23 XP_017216505.1 PREDICTED: hydrophobic protein RCI2B [Daucus caro... 94 9e-23 XP_009124957.1 PREDICTED: hydrophobic protein RCI2B-like [Brassi... 94 9e-23 NP_187240.1 Low temperature and salt responsive protein family [... 94 9e-23 AAF26091.1 low temperature and salt responsive protein LTI6B [Ar... 94 1e-22 XP_002884539.1 low temperature and salt responsive protein LTI6B... 94 1e-22 XP_013622833.1 PREDICTED: hydrophobic protein RCI2A [Brassica ol... 94 1e-22 AFI47457.1 low temperature and salt responsive protein [Medicago... 94 1e-22 XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe... 93 2e-22 >OIW13474.1 hypothetical protein TanjilG_22265 [Lupinus angustifolius] Length = 54 Score = 101 bits (251), Expect = 1e-25 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFVDIILA+ILPPLGVFLRFG E EFWICLVLTFLGY+PGIIYA++ ITK Sbjct: 1 MSTATFVDIILAVILPPLGVFLRFGCEVEFWICLVLTFLGYIPGIIYAVYAITK 54 >XP_003626131.1 low temperature and salt responsive family protein [Medicago truncatula] ABD33189.1 Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] AES82349.1 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 97.8 bits (242), Expect = 3e-24 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TATFVDIIL+I+LPPLGVFL+FGLE EFWICLVLT GYLPGIIYAI++ITK Sbjct: 1 MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYIITK 54 >XP_010694118.1 PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris] KMS98601.1 hypothetical protein BVRB_3g070440 [Beta vulgaris subsp. vulgaris] Length = 54 Score = 97.4 bits (241), Expect = 4e-24 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+ +TF+DIILAIILPPLGVFL+FG+ETEFWIC+V TF GYLPGIIYA++VITK Sbjct: 1 MSDSTFIDIILAIILPPLGVFLKFGIETEFWICVVCTFFGYLPGIIYAVYVITK 54 >XP_010674472.1 PREDICTED: hydrophobic protein RCI2B isoform X2 [Beta vulgaris subsp. vulgaris] XP_010674473.1 PREDICTED: hydrophobic protein RCI2B isoform X2 [Beta vulgaris subsp. vulgaris] KMT14113.1 hypothetical protein BVRB_4g079350 [Beta vulgaris subsp. vulgaris] Length = 54 Score = 97.1 bits (240), Expect = 6e-24 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATF+DIILAIILPPLGVFL++G + EFWICLVLT LGYLPGIIYAI+VITK Sbjct: 1 MSTATFIDIILAIILPPLGVFLKYGCKVEFWICLVLTLLGYLPGIIYAIWVITK 54 >XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus carota subsp. sativus] KZM96817.1 hypothetical protein DCAR_015821 [Daucus carota subsp. sativus] Length = 56 Score = 96.7 bits (239), Expect = 8e-24 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +2 Query: 17 TATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 TATF+DIILAIILPPLGVFL+FG EFWICL+LTFLGY+PGIIYAI+VITK Sbjct: 5 TATFIDIILAIILPPLGVFLKFGCHVEFWICLLLTFLGYIPGIIYAIYVITK 56 >NP_187239.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNQ7.1 RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A AAF26090.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAK50619.1 hydrophobic protein RCI2A [Arabidopsis thaliana] AAC97512.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAD17302.1 hydrophobic protein [Arabidopsis thaliana] AAK59845.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAK63963.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAL76128.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AEE74311.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP02097.1 RCI2A [Arabidopsis thaliana] Length = 54 Score = 96.3 bits (238), Expect = 1e-23 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFVDII+AI+LPPLGVFLRFG EFWICLVLT LGY+PGIIYAI+V+TK Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >XP_019093489.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019093498.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019091986.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019091987.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] AFK81273.1 rare cold-inducible protein 2A [Camelina sativa] AFK81275.1 rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 95.9 bits (237), Expect = 2e-23 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFVDII+A++LPPLGVFLRFG EFWICLVLT LGY+PGIIYAI+V+TK Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 96.7 bits (239), Expect = 2e-23 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = +2 Query: 5 INMTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 I M TATFVDII+AI+LPPLGVFL+FG E EFWICL+LT GYLPGIIYAI+++TK Sbjct: 38 IRMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume] ONI04114.1 hypothetical protein PRUPE_6G303600 [Prunus persica] Length = 54 Score = 95.1 bits (235), Expect = 3e-23 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TATFVDII+AI+LPPLGVFL+FG E EFWICL+LT GYLPGIIYAI+++TK Sbjct: 1 MGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 54 >XP_009134854.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] XP_009134855.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa] XP_013735929.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] XP_013735930.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] Length = 54 Score = 94.7 bits (234), Expect = 5e-23 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TATF+DI+LAI+LPPLGVFLR+G EFWICLVLT LGYLPGIIYA+FV+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALFVLTK 54 >XP_009124956.1 PREDICTED: hydrophobic protein RCI2B [Brassica rapa] XP_013624616.1 PREDICTED: hydrophobic protein RCI2B [Brassica oleracea var. oleracea] XP_013647887.1 PREDICTED: hydrophobic protein RCI2B [Brassica napus] XP_013725410.1 PREDICTED: hydrophobic protein RCI2B [Brassica napus] XP_018441125.1 PREDICTED: hydrophobic protein RCI2B [Raphanus sativus] Length = 55 Score = 94.4 bits (233), Expect = 7e-23 Identities = 40/54 (74%), Positives = 51/54 (94%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFV+I+LAI+LPPLGVFL+FGL+ EFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEILLAILLPPLGVFLKFGLKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_019093512.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] XP_019091984.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] XP_019096126.1 PREDICTED: hydrophobic protein RCI2B-like [Camelina sativa] Length = 54 Score = 94.0 bits (232), Expect = 9e-23 Identities = 40/54 (74%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 MTTATFV+I+LAI+LPPLGVFL+FG + EFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MTTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_017216505.1 PREDICTED: hydrophobic protein RCI2B [Daucus carota subsp. sativus] KZM88233.1 hypothetical protein DCAR_025308 [Daucus carota subsp. sativus] Length = 54 Score = 94.0 bits (232), Expect = 9e-23 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TATFV+IILAIILPPLGVFLRF + EFWICL+LTFLGYLPGI+YA++V+TK Sbjct: 1 MGTATFVEIILAIILPPLGVFLRFECQVEFWICLLLTFLGYLPGILYALYVLTK 54 >XP_009124957.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica rapa] XP_013624669.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica oleracea var. oleracea] XP_013647899.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] XP_013725411.1 PREDICTED: hydrophobic protein RCI2B-like [Brassica napus] XP_018441126.1 PREDICTED: hydrophobic protein RCI2B-like [Raphanus sativus] Length = 54 Score = 94.0 bits (232), Expect = 9e-23 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TATF+DI+LAI+LPPLGVFLR+G E EFWICLVLT GYLPGI+YA++V+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCEVEFWICLVLTLFGYLPGILYALYVLTK 54 >NP_187240.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNS6.1 RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B AAF23227.1 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] AAK50618.1 hydrophobic protein RCI2B [Arabidopsis thaliana] AAC97511.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] AAD17303.1 hydrophobic protein [Arabidopsis thaliana] AAM61275.1 hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] BAD44016.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] ABG25095.1 At3g05890 [Arabidopsis thaliana] BAF00618.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] AEE74312.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP04511.1 RCI2B [Arabidopsis thaliana] Length = 54 Score = 94.0 bits (232), Expect = 9e-23 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFV+IILAIILPPLGVFL+FG + EFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >AAF26091.1 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 94.0 bits (232), Expect = 1e-22 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFV+IILAIILPPLGVFL+FG + EFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_002884539.1 low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] EFH60798.1 low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 94.0 bits (232), Expect = 1e-22 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M+TATFV+IILAIILPPLGVFL+FG + EFWICL+LT GYLPGI+YA+++ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >XP_013622833.1 PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] XP_013622834.1 PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] XP_013684481.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] XP_013684482.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] XP_013684483.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] CDY49984.1 BnaC03g34410D [Brassica napus] Length = 54 Score = 93.6 bits (231), Expect = 1e-22 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TATF+DI+LAI+LPPLGVFLR+G EFWICLVLT LGYLPGIIYA++V+TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALYVLTK 54 >AFI47457.1 low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 93.6 bits (231), Expect = 1e-22 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M TAT VDIILAIILPPLGVFL+FG EFWICL+LT LGYLPGI+YAI+VITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAIYVITK 54 >XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe guttata] EYU19377.1 hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata] Length = 54 Score = 93.2 bits (230), Expect = 2e-22 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +2 Query: 11 MTTATFVDIILAIILPPLGVFLRFGLETEFWICLVLTFLGYLPGIIYAIFVITK 172 M +ATFVDII+AI+LPPLGVFL+FG E EFWICLVLT GYLPGIIYAI+ ITK Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54