BLASTX nr result
ID: Papaver32_contig00019138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00019138 (436 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009600740.1 PREDICTED: F-box protein At1g78100 [Nicotiana tom... 54 7e-06 >XP_009600740.1 PREDICTED: F-box protein At1g78100 [Nicotiana tomentosiformis] XP_016435846.1 PREDICTED: F-box protein At1g78100-like [Nicotiana tabacum] Length = 344 Score = 54.3 bits (129), Expect = 7e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -3 Query: 413 KSEVEERQEDKELALGSF--DGVFGEAVEALMKRRSYLLEMNSF 288 +SEVEE+ D LALG+F D ++GEAVE L+K RSY+LEMNSF Sbjct: 301 RSEVEEQNGDVGLALGAFGDDAMYGEAVERLLKSRSYILEMNSF 344