BLASTX nr result
ID: Papaver32_contig00018994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00018994 (687 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010925250.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 93 4e-18 XP_008785212.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 91 1e-17 ONK81011.1 uncharacterized protein A4U43_C01F24280 [Asparagus of... 90 4e-17 XP_020087995.1 peptidyl-prolyl cis-trans isomerase CYP95 [Ananas... 90 4e-17 ERN01482.1 hypothetical protein AMTR_s00002p00269760 [Amborella ... 89 7e-17 XP_006838913.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 89 7e-17 XP_010914921.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 89 9e-17 XP_010914920.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 89 9e-17 XP_009419289.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 88 2e-16 GAV70565.1 Pro_isomerase domain-containing protein [Cephalotus f... 88 2e-16 XP_010546571.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 87 3e-16 XP_010546569.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 87 3e-16 XP_009381127.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 87 6e-16 XP_010648639.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-15 XP_010648638.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-15 XP_002285000.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-15 XP_006483323.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-15 XP_006483322.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-15 XP_006450486.1 hypothetical protein CICLE_v10007495mg [Citrus cl... 86 1e-15 XP_006483320.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 86 1e-15 >XP_010925250.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] XP_010925251.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] XP_010925252.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] Length = 842 Score = 92.8 bits (229), Expect = 4e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N GRS+SRSASPDGSPKR+RRGRGFS KY YARRYRTPSPDRSP+RSH Sbjct: 636 NHGRSLSRSASPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSH 683 >XP_008785212.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] XP_017697447.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] Length = 818 Score = 91.3 bits (225), Expect = 1e-17 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N GRS+SRS SPDGSPKR+RRGRGFS KY YARRYRTPSPDRSP+RSH Sbjct: 612 NHGRSLSRSTSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSH 659 >ONK81011.1 uncharacterized protein A4U43_C01F24280 [Asparagus officinalis] Length = 823 Score = 90.1 bits (222), Expect = 4e-17 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 NRGRS SRSASPDGSPKR++RGRGFS+KY YARRYRT SPDRSPIRSH Sbjct: 634 NRGRSFSRSASPDGSPKRIQRGRGFSEKYSYARRYRTRSPDRSPIRSH 681 >XP_020087995.1 peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] XP_020087996.1 peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] OAY82935.1 Peptidyl-prolyl cis-trans isomerase CYP63 [Ananas comosus] Length = 826 Score = 90.1 bits (222), Expect = 4e-17 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 NRGRS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSP+RSP+RS+ Sbjct: 625 NRGRSLSRSGSPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSY 672 >ERN01482.1 hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda] Length = 795 Score = 89.4 bits (220), Expect = 7e-17 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N GRSVSRS SPDG+PKR+RRGRGFSQ+Y YARRYRTPSPDRSP+RS+ Sbjct: 582 NHGRSVSRSPSPDGTPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSY 629 >XP_006838913.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Amborella trichopoda] Length = 800 Score = 89.4 bits (220), Expect = 7e-17 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N GRSVSRS SPDG+PKR+RRGRGFSQ+Y YARRYRTPSPDRSP+RS+ Sbjct: 587 NHGRSVSRSPSPDGTPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSY 634 >XP_010914921.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Elaeis guineensis] Length = 726 Score = 89.0 bits (219), Expect = 9e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N RS+SRS SPDGSPKR+RRGRGFS KY YARRYRTPSPDRSP+RSH Sbjct: 522 NHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSH 569 >XP_010914920.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Elaeis guineensis] Length = 836 Score = 89.0 bits (219), Expect = 9e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N RS+SRS SPDGSPKR+RRGRGFS KY YARRYRTPSPDRSP+RSH Sbjct: 632 NHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSH 679 >XP_009419289.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 819 Score = 88.2 bits (217), Expect = 2e-16 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 N RS+SRSASPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSPIR H Sbjct: 619 NHRRSLSRSASPDGSPKRIRRGRGFSQQYSYARRYRTPSPDRSPIRLH 666 >GAV70565.1 Pro_isomerase domain-containing protein [Cephalotus follicularis] Length = 784 Score = 87.8 bits (216), Expect = 2e-16 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 + GRS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSP+RS+ Sbjct: 600 DHGRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSY 647 >XP_010546571.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Tarenaya hassleriana] Length = 735 Score = 87.4 bits (215), Expect = 3e-16 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 +R RS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSP RSH Sbjct: 552 DRRRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPARSH 599 >XP_010546569.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Tarenaya hassleriana] XP_010546570.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Tarenaya hassleriana] XP_019058793.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Tarenaya hassleriana] Length = 845 Score = 87.4 bits (215), Expect = 3e-16 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 +R RS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSP RSH Sbjct: 662 DRRRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPARSH 709 >XP_009381127.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 832 Score = 86.7 bits (213), Expect = 6e-16 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 NR RS+SRS SPDGSPKR+RRGRGFSQ+Y +ARRYRTPSPDRSP+R H Sbjct: 616 NRRRSLSRSVSPDGSPKRIRRGRGFSQQYSFARRYRTPSPDRSPVRLH 663 >XP_010648639.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Vitis vinifera] Length = 686 Score = 85.9 bits (211), Expect = 1e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 +R R+VSRS SPDGSPKR+RRGRGFS++Y YARRYRTPSPDRSP+RS+ Sbjct: 500 DRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSY 547 >XP_010648638.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Vitis vinifera] Length = 795 Score = 85.9 bits (211), Expect = 1e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 +R R+VSRS SPDGSPKR+RRGRGFS++Y YARRYRTPSPDRSP+RS+ Sbjct: 609 DRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSY 656 >XP_002285000.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Vitis vinifera] XP_010648637.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Vitis vinifera] Length = 796 Score = 85.9 bits (211), Expect = 1e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -3 Query: 685 NRGRSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 +R R+VSRS SPDGSPKR+RRGRGFS++Y YARRYRTPSPDRSP+RS+ Sbjct: 610 DRSRTVSRSPSPDGSPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSY 657 >XP_006483323.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Citrus sinensis] XP_006483324.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Citrus sinensis] XP_006483325.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Citrus sinensis] Length = 691 Score = 85.5 bits (210), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 676 RSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 RS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSPIRS+ Sbjct: 509 RSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSY 553 >XP_006483322.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Citrus sinensis] Length = 792 Score = 85.5 bits (210), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 676 RSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 RS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSPIRS+ Sbjct: 610 RSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSY 654 >XP_006450486.1 hypothetical protein CICLE_v10007495mg [Citrus clementina] ESR63726.1 hypothetical protein CICLE_v10007495mg [Citrus clementina] Length = 792 Score = 85.5 bits (210), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 676 RSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 RS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSPIRS+ Sbjct: 610 RSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSY 654 >XP_006483320.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Citrus sinensis] XP_006483321.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Citrus sinensis] KDO61676.1 hypothetical protein CISIN_1g003708mg [Citrus sinensis] KDO61677.1 hypothetical protein CISIN_1g003708mg [Citrus sinensis] KDO61678.1 hypothetical protein CISIN_1g003708mg [Citrus sinensis] Length = 801 Score = 85.5 bits (210), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 676 RSVSRSASPDGSPKRLRRGRGFSQKYWYARRYRTPSPDRSPIRSH 542 RS+SRS SPDGSPKR+RRGRGFSQ+Y YARRYRTPSPDRSPIRS+ Sbjct: 619 RSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSY 663