BLASTX nr result
ID: Papaver32_contig00018751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00018751 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010243194.1 PREDICTED: uncharacterized protein LOC104587334 [... 73 1e-13 XP_010267270.1 PREDICTED: uncharacterized protein LOC104604568 [... 66 3e-10 >XP_010243194.1 PREDICTED: uncharacterized protein LOC104587334 [Nelumbo nucifera] Length = 130 Score = 73.2 bits (178), Expect = 1e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -1 Query: 491 EEEKLDIVFERQYRTETQVSHTIQVKVQPDYDLYDLENKLRTWAG 357 EEEKLDIVFE QYRTE V+HT+QVKVQPDYD+ +LE KL WAG Sbjct: 83 EEEKLDIVFENQYRTEHTVAHTVQVKVQPDYDINELEMKLCRWAG 127 >XP_010267270.1 PREDICTED: uncharacterized protein LOC104604568 [Nelumbo nucifera] Length = 212 Score = 66.2 bits (160), Expect = 3e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 491 EEEKLDIVFERQYRTETQVSHTIQVKVQPDYDLYDLENKLRTWAG 357 EEEKL IV E QYRTET+VSHT+ V+V+PDYD+ +LE KL WAG Sbjct: 165 EEEKLAIVSENQYRTETKVSHTVLVRVKPDYDVDELEKKLCRWAG 209