BLASTX nr result
ID: Papaver32_contig00018514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00018514 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015896055.1 PREDICTED: glutamine-dependent NAD(+) synthetase ... 55 9e-06 XP_010094854.1 Glutamine-dependent NAD(+) synthetase [Morus nota... 55 9e-06 >XP_015896055.1 PREDICTED: glutamine-dependent NAD(+) synthetase [Ziziphus jujuba] Length = 733 Score = 54.7 bits (130), Expect = 9e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -1 Query: 119 SPCFILPPLVPYHVEVFLNASGSHHQLRKLDVRLRAFIG 3 +PC L VEVF+NASGSHHQLRKLDVRLRAFIG Sbjct: 179 TPCPPHAELALNGVEVFMNASGSHHQLRKLDVRLRAFIG 217 >XP_010094854.1 Glutamine-dependent NAD(+) synthetase [Morus notabilis] EXB57383.1 Glutamine-dependent NAD(+) synthetase [Morus notabilis] Length = 733 Score = 54.7 bits (130), Expect = 9e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -1 Query: 119 SPCFILPPLVPYHVEVFLNASGSHHQLRKLDVRLRAFIG 3 +PC L VEVF+NASGSHHQLRKLDVRLRAFIG Sbjct: 179 TPCPPHAELALNGVEVFMNASGSHHQLRKLDVRLRAFIG 217