BLASTX nr result
ID: Papaver32_contig00017783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00017783 (554 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010252133.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 42 1e-07 ONK62292.1 uncharacterized protein A4U43_C07F2400 [Asparagus off... 44 2e-07 XP_002533589.2 PREDICTED: putative E3 ubiquitin-protein ligase X... 42 2e-07 EEF28793.1 protein binding protein, putative [Ricinus communis] 42 2e-07 XP_020085930.1 E3 ubiquitin-protein ligase XB3-like [Ananas como... 42 3e-07 XP_017235064.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 42 4e-07 XP_006424812.1 hypothetical protein CICLE_v10028459mg [Citrus cl... 41 5e-07 KDO72874.1 hypothetical protein CISIN_1g041054mg, partial [Citru... 41 5e-07 ABP06278.1 ubiquitin ligase [Mirabilis jalapa] 41 7e-07 XP_013614500.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 40 9e-07 XP_010557276.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 41 9e-07 XP_002283965.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 41 9e-07 XP_016740448.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 40 9e-07 CBI16150.3 unnamed protein product, partial [Vitis vinifera] 41 9e-07 KVI03603.1 Ankyrin repeat-containing protein [Cynara cardunculus... 42 9e-07 XP_013687272.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 41 1e-06 XP_013676418.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 41 1e-06 XP_011089454.1 PREDICTED: putative E3 ubiquitin-protein ligase X... 41 1e-06 KVH94625.1 Ankyrin repeat-containing protein [Cynara cardunculus... 42 1e-06 OAY51806.1 hypothetical protein MANES_04G034200 [Manihot esculenta] 40 1e-06 >XP_010252133.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Nelumbo nucifera] Length = 443 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN +AKVLLE LI Sbjct: 250 SSAEPLVWPSPLKFISELNPEAKVLLERALI 280 Score = 40.4 bits (93), Expect(2) = 1e-07 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK+KHGAC+ALLNP Sbjct: 230 IPYMVALKYKHGACAALLNP 249 >ONK62292.1 uncharacterized protein A4U43_C07F2400 [Asparagus officinalis] Length = 444 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN DAK+LLE L+ Sbjct: 251 STAEPLVWPSPLKFISELNNDAKILLENALM 281 Score = 38.9 bits (89), Expect(2) = 2e-07 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPYAIALK HGAC+ALLNP Sbjct: 231 IPYAIALKRNHGACAALLNP 250 >XP_002533589.2 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Ricinus communis] Length = 373 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 190 RSIPYAIALKWKHGACSALLNP 125 R IPYA+ALK KHGAC+ALLNP Sbjct: 155 RRIPYAVALKHKHGACAALLNP 176 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN +AK LLE L+ Sbjct: 177 SSAEPLVWPSPLKFISELNQEAKALLECALM 207 >EEF28793.1 protein binding protein, putative [Ricinus communis] Length = 221 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 190 RSIPYAIALKWKHGACSALLNP 125 R IPYA+ALK KHGAC+ALLNP Sbjct: 3 RRIPYAVALKHKHGACAALLNP 24 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN +AK LLE L+ Sbjct: 25 SSAEPLVWPSPLKFISELNQEAKALLECALM 55 >XP_020085930.1 E3 ubiquitin-protein ligase XB3-like [Ananas comosus] OAY72172.1 E3 ubiquitin-protein ligase XB3 [Ananas comosus] Length = 442 Score = 42.4 bits (98), Expect(2) = 3e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN DAK LLE L+ Sbjct: 251 SSAEPMVWPSPLKFISELNPDAKALLEAALM 281 Score = 39.3 bits (90), Expect(2) = 3e-07 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPYA+ALK +HGAC+ALLNP Sbjct: 231 IPYAVALKRRHGACAALLNP 250 >XP_017235064.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Daucus carota subsp. sativus] KZN04485.1 hypothetical protein DCAR_005322 [Daucus carota subsp. sativus] Length = 445 Score = 42.4 bits (98), Expect(2) = 4e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -2 Query: 232 RHGRNSNNAFGGHGRSIPYAIALKWKHGACSALLNP 125 RH R+S+ GR IPY IALK+KHGAC+ALLNP Sbjct: 223 RHQRDSS------GR-IPYIIALKYKHGACAALLNP 251 Score = 38.9 bits (89), Expect(2) = 4e-07 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFI+ELN +AK LLE L+ Sbjct: 252 SSAEPLVWPSPLKFIAELNQEAKALLEQALM 282 >XP_006424812.1 hypothetical protein CICLE_v10028459mg [Citrus clementina] XP_006488310.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Citrus sinensis] ESR38052.1 hypothetical protein CICLE_v10028459mg [Citrus clementina] Length = 443 Score = 40.8 bits (94), Expect(2) = 5e-07 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPYA+ALK KHGAC+ALLNP Sbjct: 230 IPYAVALKHKHGACAALLNP 249 Score = 40.0 bits (92), Expect(2) = 5e-07 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -3 Query: 114 EPSV*PSPLKFISELNLDAKVLLEGELI 31 EP V PSPLKFISELN +AK LLE L+ Sbjct: 253 EPLVWPSPLKFISELNQEAKALLENALM 280 >KDO72874.1 hypothetical protein CISIN_1g041054mg, partial [Citrus sinensis] Length = 298 Score = 40.8 bits (94), Expect(2) = 5e-07 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPYA+ALK KHGAC+ALLNP Sbjct: 85 IPYAVALKHKHGACAALLNP 104 Score = 40.0 bits (92), Expect(2) = 5e-07 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -3 Query: 114 EPSV*PSPLKFISELNLDAKVLLEGELI 31 EP V PSPLKFISELN +AK LLE L+ Sbjct: 108 EPLVWPSPLKFISELNQEAKALLENALM 135 >ABP06278.1 ubiquitin ligase [Mirabilis jalapa] Length = 446 Score = 41.2 bits (95), Expect(2) = 7e-07 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 114 EPSV*PSPLKFISELNLDAKVLLEGELI 31 EP V PSPLKFISELN DAK+LLE L+ Sbjct: 259 EPLVWPSPLKFISELNPDAKLLLERALL 286 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK KHGAC+ALLNP Sbjct: 236 IPYTVALKHKHGACAALLNP 255 >XP_013614500.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Brassica oleracea var. oleracea] Length = 453 Score = 40.0 bits (92), Expect(2) = 9e-07 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -2 Query: 199 GHGRSIPYAIALKWKHGACSALLNP 125 G G+ IPY +A+K+KHGAC ALLNP Sbjct: 226 GSGK-IPYVVAMKYKHGACGALLNP 249 Score = 40.0 bits (92), Expect(2) = 9e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN +AK+LLE L+ Sbjct: 250 SSAEPLVWPSPLKFISELNEEAKLLLEQALM 280 >XP_010557276.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Tarenaya hassleriana] Length = 447 Score = 40.8 bits (94), Expect(2) = 9e-07 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPYA+ALK KHGAC+ALLNP Sbjct: 230 IPYAVALKHKHGACAALLNP 249 Score = 39.3 bits (90), Expect(2) = 9e-07 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN +AK LLE L+ Sbjct: 250 SSAEPLVWPSPLKFISELNDEAKALLEQALM 280 >XP_002283965.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Vitis vinifera] Length = 445 Score = 40.8 bits (94), Expect(2) = 9e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 114 EPSV*PSPLKFISELNLDAKVLLEGELI 31 EP V PSPLKFISELN DAK LLE L+ Sbjct: 253 EPLVWPSPLKFISELNQDAKALLEQALM 280 Score = 39.3 bits (90), Expect(2) = 9e-07 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK KHGAC+ALLNP Sbjct: 230 IPYVVALKHKHGACAALLNP 249 >XP_016740448.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Gossypium hirsutum] Length = 440 Score = 40.4 bits (93), Expect(2) = 9e-07 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK+KHGAC+ALLNP Sbjct: 230 IPYIVALKYKHGACAALLNP 249 Score = 39.7 bits (91), Expect(2) = 9e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V P+PLKFISELN +AKVLLE L+ Sbjct: 250 SSAEPLVWPAPLKFISELNDEAKVLLEQALM 280 >CBI16150.3 unnamed protein product, partial [Vitis vinifera] Length = 395 Score = 40.8 bits (94), Expect(2) = 9e-07 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 114 EPSV*PSPLKFISELNLDAKVLLEGELI 31 EP V PSPLKFISELN DAK LLE L+ Sbjct: 253 EPLVWPSPLKFISELNQDAKALLEQALM 280 Score = 39.3 bits (90), Expect(2) = 9e-07 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK KHGAC+ALLNP Sbjct: 230 IPYVVALKHKHGACAALLNP 249 >KVI03603.1 Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 392 Score = 41.6 bits (96), Expect(2) = 9e-07 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN DAK LLE L+ Sbjct: 215 SSAEPLVWPSPLKFISELNQDAKALLEQALM 245 Score = 38.5 bits (88), Expect(2) = 9e-07 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 202 GGHGRSIPYAIALKWKHGACSALLNP 125 GG+GR IPY +ALK K+ AC+ALLNP Sbjct: 190 GGYGR-IPYLVALKHKNDACAALLNP 214 >XP_013687272.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Brassica napus] Length = 453 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 199 GHGRSIPYAIALKWKHGACSALLNP 125 G GR IPY +A+K+KHGAC ALLNP Sbjct: 226 GSGR-IPYVVAMKYKHGACGALLNP 249 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFI ELN +AK+LLE L+ Sbjct: 250 SSAEPLVWPSPLKFIGELNEEAKLLLEQALM 280 >XP_013676418.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Brassica napus] XP_013687273.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Brassica napus] CDX77214.1 BnaC04g40090D [Brassica napus] Length = 453 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 199 GHGRSIPYAIALKWKHGACSALLNP 125 G GR IPY +A+K+KHGAC ALLNP Sbjct: 226 GSGR-IPYVVAMKYKHGACGALLNP 249 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFI ELN +AK+LLE L+ Sbjct: 250 SSAEPLVWPSPLKFIGELNEEAKLLLEQALM 280 >XP_011089454.1 PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Sesamum indicum] Length = 448 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN DAK LLE L+ Sbjct: 250 SSAEPLVWPSPLKFISELNHDAKALLERALM 280 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK+ HGAC+ALLNP Sbjct: 230 IPYTVALKYHHGACAALLNP 249 >KVH94625.1 Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 418 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN DAK LLE L+ Sbjct: 227 SSAEPLVWPSPLKFISELNQDAKALLEQALM 257 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPYA+ALK K+GAC+ALLNP Sbjct: 207 IPYAVALKHKNGACAALLNP 226 >OAY51806.1 hypothetical protein MANES_04G034200 [Manihot esculenta] Length = 446 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 123 SLVEPSV*PSPLKFISELNLDAKVLLEGELI 31 S EP V PSPLKFISELN +AK LLE L+ Sbjct: 250 SATEPLVWPSPLKFISELNQEAKALLERALM 280 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 184 IPYAIALKWKHGACSALLNP 125 IPY +ALK KHGAC+ALLNP Sbjct: 230 IPYLVALKHKHGACAALLNP 249