BLASTX nr result
ID: Papaver32_contig00017753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00017753 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001308778.1 UBP26 [Zea mays] 60 5e-09 ACG43944.1 UBP26 [Zea mays] 60 5e-09 XP_016565100.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 63 1e-08 XP_016565094.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 63 1e-08 ONL94886.1 Ubiquitin carboxyl-terminal hydrolase 26 [Zea mays] 59 1e-08 XP_009377352.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 4e-08 XP_019245944.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 4e-08 XP_009793247.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 4e-08 XP_009631825.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 4e-08 OEL12988.1 Ubiquitin carboxyl-terminal hydrolase 26 [Dichantheli... 61 5e-08 XP_015690978.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 5e-08 XP_017178688.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 5e-08 XP_009363586.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 5e-08 XP_008393981.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 5e-08 XP_008219811.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 61 5e-08 XP_007225411.1 hypothetical protein PRUPE_ppa000584mg [Prunus pe... 61 5e-08 XP_004962970.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 60 7e-08 XP_006355139.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 60 7e-08 XP_004303444.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase ... 60 1e-07 ONM54361.1 UBP26 [Zea mays] 60 1e-07 >NP_001308778.1 UBP26 [Zea mays] Length = 92 Score = 59.7 bits (143), Expect = 5e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WVRDS IYENRDIADE+S Q ++ + E GFRGTLLT+ +S Q Sbjct: 41 WVRDSEIYENRDIADEISEQKDDMLQAEEGFRGTLLTSTVSAQ 83 >ACG43944.1 UBP26 [Zea mays] Length = 92 Score = 59.7 bits (143), Expect = 5e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WVRDS IYENRDIADE+S Q ++ + E GFRGTLLT+ +S Q Sbjct: 41 WVRDSEIYENRDIADEISEQKDDMLQAEEGFRGTLLTSTVSAQ 83 >XP_016565100.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X2 [Capsicum annuum] Length = 1093 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+E+RDIADELSGQ E K TE GFRGTLL++ IS+Q Sbjct: 1041 WVTDSEIHEHRDIADELSGQKVEAKNTEEGFRGTLLSSSISSQ 1083 >XP_016565094.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Capsicum annuum] XP_016565095.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Capsicum annuum] XP_016565096.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Capsicum annuum] XP_016565097.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Capsicum annuum] XP_016565098.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Capsicum annuum] XP_016565099.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Capsicum annuum] Length = 1098 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+E+RDIADELSGQ E K TE GFRGTLL++ IS+Q Sbjct: 1046 WVTDSEIHEHRDIADELSGQKVEAKNTEEGFRGTLLSSSISSQ 1088 >ONL94886.1 Ubiquitin carboxyl-terminal hydrolase 26 [Zea mays] Length = 92 Score = 58.5 bits (140), Expect = 1e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WVRDS I+ENRDIADE+S Q ++ + E GFRGTLLT+ +S Q Sbjct: 41 WVRDSEIFENRDIADEISEQKGDILQVEEGFRGTLLTSSVSAQ 83 >XP_009377352.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like isoform X1 [Pyrus x bretschneideri] XP_009377353.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like isoform X1 [Pyrus x bretschneideri] XP_009377355.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like isoform X1 [Pyrus x bretschneideri] XP_009377356.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like isoform X1 [Pyrus x bretschneideri] Length = 1084 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+ENRDIADELS Q + + TE GFRGTLLTT +S+Q Sbjct: 1040 WVNDSEIHENRDIADELSDQKMDAQHTEEGFRGTLLTTNVSSQ 1082 >XP_019245944.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Nicotiana attenuata] OIT03612.1 ubiquitin carboxyl-terminal hydrolase 26 [Nicotiana attenuata] Length = 1095 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISN 318 WV DS I+E+RDIADELSGQ TE + TE GFRGTLL++ IS+ Sbjct: 1043 WVTDSEIHEHRDIADELSGQKTEAQNTEEGFRGTLLSSSISS 1084 >XP_009793247.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Nicotiana sylvestris] XP_016487215.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Nicotiana tabacum] Length = 1095 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISN 318 WV DS I+E+RDIADELSGQ TE + TE GFRGTLL++ IS+ Sbjct: 1043 WVTDSEIHEHRDIADELSGQKTEAQNTEEGFRGTLLSSSISS 1084 >XP_009631825.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Nicotiana tomentosiformis] XP_016470244.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like isoform X1 [Nicotiana tabacum] XP_016470251.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like isoform X1 [Nicotiana tabacum] Length = 1095 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISN 318 WV DS I+E+RDIADELSGQ TE + TE GFRGTLL++ IS+ Sbjct: 1043 WVTDSEIHEHRDIADELSGQKTEAQNTEEGFRGTLLSSSISS 1084 >OEL12988.1 Ubiquitin carboxyl-terminal hydrolase 26 [Dichanthelium oligosanthes] Length = 1001 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WVRDS IYENRDIADE+S Q +++ + E GFRGTLLT+ IS Q Sbjct: 950 WVRDSEIYENRDIADEISEQKSDMLQAEEGFRGTLLTSSISAQ 992 >XP_015690978.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Oryza brachyantha] XP_006649541.2 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Oryza brachyantha] Length = 1073 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV+D+ IYENRDIADE+S Q +V +TE GFRGTLLT+ +S Q Sbjct: 1022 WVKDTEIYENRDIADEISEQKVDVLQTEEGFRGTLLTSSVSAQ 1064 >XP_017178688.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X2 [Malus domestica] Length = 1084 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+ENRDIADELS Q +V+ TE GFRGTLLT +S+Q Sbjct: 1040 WVNDSEIHENRDIADELSDQKMDVQHTEEGFRGTLLTANVSSQ 1082 >XP_009363586.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Pyrus x bretschneideri] XP_009363587.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Pyrus x bretschneideri] Length = 1085 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+ENRDIADELS Q +V+ TE GFRGTLLT +S+Q Sbjct: 1041 WVNDSEIHENRDIADELSDQKMDVQHTEEGFRGTLLTANVSSQ 1083 >XP_008393981.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Malus domestica] XP_008393982.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Malus domestica] Length = 1085 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+ENRDIADELS Q +V+ TE GFRGTLLT +S+Q Sbjct: 1041 WVNDSEIHENRDIADELSDQKMDVQHTEEGFRGTLLTANVSSQ 1083 >XP_008219811.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Prunus mume] XP_016647833.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 isoform X1 [Prunus mume] Length = 1087 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+ENRDIADELS Q +V+ TE GFRGTLLT +S+Q Sbjct: 1043 WVNDSEIHENRDIADELSDQKMDVQHTEEGFRGTLLTANVSSQ 1085 >XP_007225411.1 hypothetical protein PRUPE_ppa000584mg [Prunus persica] ONI34101.1 hypothetical protein PRUPE_1G462800 [Prunus persica] Length = 1087 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+ENRDIADELS Q +V+ TE GFRGTLLT +S+Q Sbjct: 1043 WVNDSEIHENRDIADELSDQKMDVQHTEEGFRGTLLTANVSSQ 1085 >XP_004962970.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Setaria italica] XP_012700211.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Setaria italica] KQL16899.1 hypothetical protein SETIT_021051mg [Setaria italica] Length = 1075 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WVRDS IYENRDIADE+S Q ++ + E GFRGTLLT+ +S Q Sbjct: 1024 WVRDSEIYENRDIADEISDQKADMLQAEEGFRGTLLTSSVSAQ 1066 >XP_006355139.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Solanum tuberosum] Length = 1091 Score = 60.5 bits (145), Expect = 7e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS I+E+RDIADELSGQ E ++TE GFRGTLL++ +S+Q Sbjct: 1039 WVTDSEIHEHRDIADELSGQKMEERKTEEGFRGTLLSSSLSSQ 1081 >XP_004303444.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Fragaria vesca subsp. vesca] Length = 1085 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WV DS ++ENRDIADELS Q +V+ TE GFRGTLLT +S+Q Sbjct: 1041 WVTDSEVHENRDIADELSDQKMDVQHTEEGFRGTLLTANVSSQ 1083 >ONM54361.1 UBP26 [Zea mays] Length = 774 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 443 WVRDSGIYENRDIADELSGQHTEVKRTEGGFRGTLLTTCISNQ 315 WVRDS IYENRDIADE+S Q ++ + E GFRGTLLT+ +S Q Sbjct: 723 WVRDSEIYENRDIADEISEQKDDMLQAEEGFRGTLLTSTVSAQ 765