BLASTX nr result
ID: Papaver32_contig00016930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00016930 (490 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010257410.1 PREDICTED: rhodanese-like domain-containing prote... 68 5e-12 XP_010036471.1 PREDICTED: rhodanese-like domain-containing prote... 70 8e-12 XP_010036470.1 PREDICTED: rhodanese-like domain-containing prote... 70 1e-11 ONK70063.1 uncharacterized protein A4U43_C05F29860 [Asparagus of... 70 1e-11 XP_010036469.1 PREDICTED: rhodanese-like domain-containing prote... 70 1e-11 ACJ86195.1 unknown [Medicago truncatula] 70 2e-11 XP_003625225.1 rhodanese/cell cycle control phosphatase superfam... 70 2e-11 XP_011075172.1 PREDICTED: rhodanese-like domain-containing prote... 69 2e-11 OAY43154.1 hypothetical protein MANES_08G046500 [Manihot esculenta] 69 3e-11 OAY43153.1 hypothetical protein MANES_08G046500 [Manihot esculenta] 69 4e-11 XP_011020266.1 PREDICTED: rhodanese-like domain-containing prote... 69 4e-11 XP_015871209.1 PREDICTED: rhodanese-like domain-containing prote... 69 4e-11 XP_004304383.1 PREDICTED: rhodanese-like domain-containing prote... 69 4e-11 XP_015871137.1 PREDICTED: rhodanese-like domain-containing prote... 69 4e-11 GAU23439.1 hypothetical protein TSUD_331370 [Trifolium subterran... 69 4e-11 XP_006381056.1 rhodanese-like domain-containing family protein [... 69 5e-11 XP_019054307.1 PREDICTED: rhodanese-like domain-containing prote... 68 6e-11 AKM76382.1 rhodanese/cell cycle control phosphatase superfamily ... 68 9e-11 XP_016204933.1 PREDICTED: rhodanese-like domain-containing prote... 67 9e-11 XP_015969456.1 PREDICTED: rhodanese-like domain-containing prote... 67 9e-11 >XP_010257410.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic [Nelumbo nucifera] Length = 100 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 VQGKISAVLGT+LICAYLFITFFP+QAEK+ QLVP S Sbjct: 64 VQGKISAVLGTMLICAYLFITFFPEQAEKLFQLVPAS 100 >XP_010036471.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X3 [Eucalyptus grandis] KCW48082.1 hypothetical protein EUGRSUZ_K01824 [Eucalyptus grandis] Length = 204 Score = 70.1 bits (170), Expect = 8e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVL+CA+LFITFFPDQAEK+LQLVP S Sbjct: 168 IQGKISAVLGTVLVCAFLFITFFPDQAEKLLQLVPAS 204 >XP_010036470.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Eucalyptus grandis] Length = 222 Score = 70.1 bits (170), Expect = 1e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVL+CA+LFITFFPDQAEK+LQLVP S Sbjct: 186 IQGKISAVLGTVLVCAFLFITFFPDQAEKLLQLVPAS 222 >ONK70063.1 uncharacterized protein A4U43_C05F29860 [Asparagus officinalis] Length = 231 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 VQGKISAVLGTVLICAYLFITFFPDQAEKILQ+ P S Sbjct: 195 VQGKISAVLGTVLICAYLFITFFPDQAEKILQMSPAS 231 >XP_010036469.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Eucalyptus grandis] KCW48080.1 hypothetical protein EUGRSUZ_K01824 [Eucalyptus grandis] KCW48081.1 hypothetical protein EUGRSUZ_K01824 [Eucalyptus grandis] Length = 233 Score = 70.1 bits (170), Expect = 1e-11 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVL+CA+LFITFFPDQAEK+LQLVP S Sbjct: 197 IQGKISAVLGTVLVCAFLFITFFPDQAEKLLQLVPAS 233 >ACJ86195.1 unknown [Medicago truncatula] Length = 234 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKISAVLGTVLICAYLFITFFPDQAEK++QLVP Sbjct: 198 IQGKISAVLGTVLICAYLFITFFPDQAEKLIQLVP 232 >XP_003625225.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] ABN08644.1 Rhodanese-like [Medicago truncatula] AES81443.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] AFK44436.1 unknown [Medicago truncatula] Length = 234 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKISAVLGTVLICAYLFITFFPDQAEK++QLVP Sbjct: 198 IQGKISAVLGTVLICAYLFITFFPDQAEKLIQLVP 232 >XP_011075172.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Sesamum indicum] Length = 233 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKISAVLGTVLICAYLFITFFPDQAEK+L+LVP Sbjct: 197 IQGKISAVLGTVLICAYLFITFFPDQAEKLLELVP 231 >OAY43154.1 hypothetical protein MANES_08G046500 [Manihot esculenta] Length = 232 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVLICAYLFITFFPDQAEK+ QL P S Sbjct: 196 IQGKISAVLGTVLICAYLFITFFPDQAEKLFQLAPAS 232 >OAY43153.1 hypothetical protein MANES_08G046500 [Manihot esculenta] Length = 235 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVLICAYLFITFFPDQAEK+ QL P S Sbjct: 199 IQGKISAVLGTVLICAYLFITFFPDQAEKLFQLAPAS 235 >XP_011020266.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic [Populus euphratica] Length = 235 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVLICAYLFITFFP+QAEK+LQL P S Sbjct: 199 IQGKISAVLGTVLICAYLFITFFPEQAEKLLQLAPSS 235 >XP_015871209.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Ziziphus jujuba] XP_015868127.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Ziziphus jujuba] Length = 236 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKISAVLGTVLICAYLFITFFPDQAEK+LQL P Sbjct: 200 IQGKISAVLGTVLICAYLFITFFPDQAEKLLQLAP 234 >XP_004304383.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Fragaria vesca subsp. vesca] Length = 238 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 VQGKISAVLGTVL+CAYLFITFFPDQAEK+LQL P Sbjct: 202 VQGKISAVLGTVLVCAYLFITFFPDQAEKLLQLAP 236 >XP_015871137.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Ziziphus jujuba] XP_015868126.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X1 [Ziziphus jujuba] Length = 240 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKISAVLGTVLICAYLFITFFPDQAEK+LQL P Sbjct: 204 IQGKISAVLGTVLICAYLFITFFPDQAEKLLQLAP 238 >GAU23439.1 hypothetical protein TSUD_331370 [Trifolium subterraneum] Length = 248 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKISAVLGTVLICAYLFITFFPDQAEK+ QLVP Sbjct: 212 IQGKISAVLGTVLICAYLFITFFPDQAEKLFQLVP 246 >XP_006381056.1 rhodanese-like domain-containing family protein [Populus trichocarpa] ERP58853.1 rhodanese-like domain-containing family protein [Populus trichocarpa] Length = 235 Score = 68.6 bits (166), Expect = 5e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 +QGKISAVLGTVL+CAYLFITFFP+QAEK+LQL P S Sbjct: 199 IQGKISAVLGTVLVCAYLFITFFPEQAEKLLQLAPSS 235 >XP_019054307.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X2 [Nelumbo nucifera] Length = 204 Score = 67.8 bits (164), Expect = 6e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVPGS 111 VQGKISAVLGTVLICAYLFITFFP+QAEK+ QL P S Sbjct: 168 VQGKISAVLGTVLICAYLFITFFPEQAEKLFQLAPAS 204 >AKM76382.1 rhodanese/cell cycle control phosphatase superfamily protein [Melianthus villosus] Length = 230 Score = 67.8 bits (164), Expect = 9e-11 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGK+SAVLGTVLICA+LFITFFPDQAEK+LQ+VP Sbjct: 194 IQGKVSAVLGTVLICAFLFITFFPDQAEKLLQMVP 228 >XP_016204933.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X4 [Arachis ipaensis] Length = 210 Score = 67.4 bits (163), Expect = 9e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKIS VLGT+L+CAYLFITFFPDQAEKI QLVP Sbjct: 174 IQGKISTVLGTILVCAYLFITFFPDQAEKIFQLVP 208 >XP_015969456.1 PREDICTED: rhodanese-like domain-containing protein 9, chloroplastic isoform X4 [Arachis duranensis] Length = 210 Score = 67.4 bits (163), Expect = 9e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 VQGKISAVLGTVLICAYLFITFFPDQAEKILQLVP 105 +QGKIS VLGT+L+CAYLFITFFPDQAEKI QLVP Sbjct: 174 IQGKISTVLGTILVCAYLFITFFPDQAEKIFQLVP 208