BLASTX nr result
ID: Papaver32_contig00016446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00016446 (665 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN61485.1 hypothetical protein VITISV_043023 [Vitis vinifera] 112 2e-28 XP_004303747.1 PREDICTED: AT-rich interactive domain-containing ... 112 7e-28 XP_008340179.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_018498869.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_008380745.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_008228116.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_007217035.1 hypothetical protein PRUPE_ppa001668mg [Prunus pe... 112 9e-28 XP_009338314.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_009357933.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_008340180.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_008358067.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 XP_008348474.1 PREDICTED: AT-rich interactive domain-containing ... 112 9e-28 ACF86696.1 unknown [Zea mays] 110 1e-27 XP_018839260.1 PREDICTED: AT-rich interactive domain-containing ... 112 1e-27 XP_015902482.1 PREDICTED: AT-rich interactive domain-containing ... 112 2e-27 XP_015901206.1 PREDICTED: AT-rich interactive domain-containing ... 112 2e-27 XP_010096547.1 AT-rich interactive domain-containing protein 4 [... 112 3e-27 EPS64738.1 hypothetical protein M569_10043, partial [Genlisea au... 110 6e-27 XP_018809891.1 PREDICTED: AT-rich interactive domain-containing ... 110 1e-26 XP_008797362.1 PREDICTED: AT-rich interactive domain-containing ... 110 1e-26 >CAN61485.1 hypothetical protein VITISV_043023 [Vitis vinifera] Length = 106 Score = 112 bits (280), Expect = 2e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 14 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 61 >XP_004303747.1 PREDICTED: AT-rich interactive domain-containing protein 4 [Fragaria vesca subsp. vesca] Length = 779 Score = 112 bits (280), Expect(2) = 7e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 677 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 724 Score = 39.7 bits (91), Expect(2) = 7e-28 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP KV+NGF Sbjct: 748 YICPHCSISNFKKKPQKVTNGF 769 >XP_008340179.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X1 [Malus domestica] Length = 790 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 688 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 735 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 759 YICPHCSISNFKKKPQKIANGF 780 >XP_018498869.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X1 [Pyrus x bretschneideri] Length = 787 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 685 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 732 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 756 YICPHCSISNFKKKPQKIANGF 777 >XP_008380745.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Malus domestica] Length = 783 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 681 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 728 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 752 YICPHCSISNFKKKPQKIANGF 773 >XP_008228116.1 PREDICTED: AT-rich interactive domain-containing protein 4 [Prunus mume] Length = 783 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 681 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 728 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 752 YICPHCSISNFKKKPQKIANGF 773 >XP_007217035.1 hypothetical protein PRUPE_ppa001668mg [Prunus persica] ONI15238.1 hypothetical protein PRUPE_3G031800 [Prunus persica] ONI15239.1 hypothetical protein PRUPE_3G031800 [Prunus persica] Length = 783 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 681 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 728 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 752 YICPHCSISNFKKKPQKIANGF 773 >XP_009338314.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X2 [Pyrus x bretschneideri] Length = 782 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 680 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 727 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 751 YICPHCSISNFKKKPQKIANGF 772 >XP_009357933.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Pyrus x bretschneideri] Length = 782 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 680 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 727 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 751 YICPHCSISNFKKKPQKIANGF 772 >XP_008340180.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X2 [Malus domestica] Length = 782 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 680 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 727 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 751 YICPHCSISNFKKKPQKIANGF 772 >XP_008358067.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Malus domestica] Length = 515 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 413 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 460 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 484 YICPHCSISNFKKKPQKIANGF 505 >XP_008348474.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Malus domestica] Length = 255 Score = 112 bits (280), Expect(2) = 9e-28 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 153 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 200 Score = 39.3 bits (90), Expect(2) = 9e-28 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP K++NGF Sbjct: 224 YICPHCSISNFKKKPQKIANGF 245 >ACF86696.1 unknown [Zea mays] Length = 118 Score = 110 bits (276), Expect = 1e-27 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSA GDWVNCG+CGEWA Sbjct: 14 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGLCGEWA 61 >XP_018839260.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Juglans regia] Length = 668 Score = 112 bits (280), Expect(2) = 1e-27 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 566 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 613 Score = 38.9 bits (89), Expect(2) = 1e-27 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI ++KP KV NGF Sbjct: 637 YICPHCSITNFKKKPQKVGNGF 658 >XP_015902482.1 PREDICTED: AT-rich interactive domain-containing protein 4 [Ziziphus jujuba] Length = 782 Score = 112 bits (280), Expect(2) = 2e-27 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 680 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 727 Score = 38.5 bits (88), Expect(2) = 2e-27 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP KV+NG+ Sbjct: 751 YICPHCSISNFKKKPQKVTNGY 772 >XP_015901206.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Ziziphus jujuba] Length = 472 Score = 112 bits (280), Expect(2) = 2e-27 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 370 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 417 Score = 38.5 bits (88), Expect(2) = 2e-27 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI+ ++KP KV+NG+ Sbjct: 441 YICPHCSISNFKKKPQKVTNGY 462 >XP_010096547.1 AT-rich interactive domain-containing protein 4 [Morus notabilis] EXB64667.1 AT-rich interactive domain-containing protein 4 [Morus notabilis] Length = 779 Score = 112 bits (280), Expect(2) = 3e-27 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCG+CGEWA Sbjct: 677 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGICGEWA 724 Score = 37.4 bits (85), Expect(2) = 3e-27 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCS++ ++K KVSNGF Sbjct: 748 YICPHCSVSNFKKKSQKVSNGF 769 >EPS64738.1 hypothetical protein M569_10043, partial [Genlisea aurea] Length = 182 Score = 110 bits (276), Expect = 6e-27 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSA GDWVNCG+CGEWA Sbjct: 84 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGLCGEWA 131 >XP_018809891.1 PREDICTED: AT-rich interactive domain-containing protein 4-like [Juglans regia] Length = 777 Score = 110 bits (275), Expect(2) = 1e-26 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSA GDWVNCG+CGEWA Sbjct: 675 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGICGEWA 722 Score = 37.7 bits (86), Expect(2) = 1e-26 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCSI ++KP KV NG+ Sbjct: 746 YICPHCSITNFKKKPQKVGNGY 767 >XP_008797362.1 PREDICTED: AT-rich interactive domain-containing protein 4-like isoform X1 [Phoenix dactylifera] Length = 852 Score = 110 bits (276), Expect(2) = 1e-26 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -3 Query: 663 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAAGDWVNCGMCGEWA 520 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSA GDWVNCG+CGEWA Sbjct: 680 GNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGLCGEWA 727 Score = 37.0 bits (84), Expect(2) = 1e-26 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -1 Query: 470 YICPHCSINYNRRKPPKVSNGF 405 YICPHCS++ ++KP K+ NGF Sbjct: 751 YICPHCSLSNYKKKPQKMVNGF 772