BLASTX nr result
ID: Papaver32_contig00016203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00016203 (612 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU40698.1 hypothetical protein MIMGU_mgv1a021759mg, partial [Er... 56 7e-06 >EYU40698.1 hypothetical protein MIMGU_mgv1a021759mg, partial [Erythranthe guttata] Length = 463 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/42 (52%), Positives = 33/42 (78%) Frame = +3 Query: 414 KKNAEKLASRVGELIRTHCPISYEDWRIVPENFKEDVWNGLM 539 + ++++ +SR G+ +R H PISY+D+R VP NFK+DVWN LM Sbjct: 422 RDHSKQWSSRTGDFVRAHIPISYKDFRDVPNNFKDDVWNALM 463