BLASTX nr result
ID: Papaver32_contig00016009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00016009 (452 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAK98155.1 hypothetical protein IQ06DRAFT_180946, partial [Stago... 102 4e-25 OAL50006.1 hypothetical protein IQ07DRAFT_539752 [Pyrenochaeta s... 102 7e-25 KNG50276.1 40s ribosomal protein s10-a [Stemphylium lycopersici] 102 7e-25 XP_008021628.1 hypothetical protein SETTUDRAFT_166814 [Setosphae... 102 7e-25 XP_014084949.1 hypothetical protein COCC4DRAFT_46636 [Bipolaris ... 102 7e-25 XP_007694133.1 hypothetical protein COCSADRAFT_31861 [Bipolaris ... 102 7e-25 KZM20939.1 hypothetical protein ST47_g7924 [Ascochyta rabiei] 102 8e-25 XP_007710915.1 hypothetical protein COCCADRAFT_92601 [Bipolaris ... 102 8e-25 XP_001935693.1 40S ribosomal protein S10 [Pyrenophora tritici-re... 102 8e-25 XP_003836407.1 hypothetical protein LEMA_P039430.1 [Leptosphaeri... 102 9e-25 XP_007686870.1 hypothetical protein COCMIDRAFT_4335 [Bipolaris o... 102 3e-24 XP_018390863.1 hypothetical protein CC77DRAFT_1016408 [Alternari... 100 5e-24 XP_018035269.1 hypothetical protein CC84DRAFT_1165265 [Paraphaeo... 97 1e-22 XP_003014219.1 hypothetical protein ARB_07524 [Trichophyton benh... 96 2e-22 OCK74273.1 hypothetical protein K432DRAFT_259779, partial [Lepid... 96 2e-22 XP_020132291.1 small subunit ribosomal protein s10e [Diplodia co... 96 2e-22 KKY13666.1 putative 40s ribosomal protein s10-a [Diplodia seriata] 96 2e-22 XP_007587847.1 putative 40s ribosomal protein s10-a protein [Neo... 96 3e-22 OMP85478.1 40S ribosomal protein S10-B [Diplodia seriata] 96 3e-22 GAD93019.1 40S ribosomal protein S10-B, putative [Byssochlamys s... 96 4e-22 >OAK98155.1 hypothetical protein IQ06DRAFT_180946, partial [Stagonospora sp. SRC1lsM3a] Length = 139 Score = 102 bits (254), Expect = 4e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 39 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 83 >OAL50006.1 hypothetical protein IQ07DRAFT_539752 [Pyrenochaeta sp. DS3sAY3a] Length = 161 Score = 102 bits (254), Expect = 7e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >KNG50276.1 40s ribosomal protein s10-a [Stemphylium lycopersici] Length = 161 Score = 102 bits (254), Expect = 7e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_008021628.1 hypothetical protein SETTUDRAFT_166814 [Setosphaeria turcica Et28A] EOA90934.1 hypothetical protein SETTUDRAFT_166814 [Setosphaeria turcica Et28A] Length = 161 Score = 102 bits (254), Expect = 7e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_014084949.1 hypothetical protein COCC4DRAFT_46636 [Bipolaris maydis ATCC 48331] EMD96181.1 hypothetical protein COCHEDRAFT_1221792 [Bipolaris maydis C5] ENI11040.1 hypothetical protein COCC4DRAFT_46636 [Bipolaris maydis ATCC 48331] Length = 161 Score = 102 bits (254), Expect = 7e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_007694133.1 hypothetical protein COCSADRAFT_31861 [Bipolaris sorokiniana ND90Pr] EMD69094.1 hypothetical protein COCSADRAFT_31861 [Bipolaris sorokiniana ND90Pr] Length = 161 Score = 102 bits (254), Expect = 7e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >KZM20939.1 hypothetical protein ST47_g7924 [Ascochyta rabiei] Length = 162 Score = 102 bits (254), Expect = 8e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_007710915.1 hypothetical protein COCCADRAFT_92601 [Bipolaris zeicola 26-R-13] XP_014559498.1 hypothetical protein COCVIDRAFT_91738 [Bipolaris victoriae FI3] EUC34803.1 hypothetical protein COCCADRAFT_92601 [Bipolaris zeicola 26-R-13] EUN29896.1 hypothetical protein COCVIDRAFT_91738 [Bipolaris victoriae FI3] Length = 163 Score = 102 bits (254), Expect = 8e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 58 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 102 >XP_001935693.1 40S ribosomal protein S10 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003297655.1 hypothetical protein PTT_08142 [Pyrenophora teres f. teres 0-1] EDU48280.1 40S ribosomal protein S10 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ94245.1 hypothetical protein PTT_08142 [Pyrenophora teres f. teres 0-1] Length = 165 Score = 102 bits (254), Expect = 8e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_003836407.1 hypothetical protein LEMA_P039430.1 [Leptosphaeria maculans JN3] CBX93042.1 hypothetical protein LEMA_P039430.1 [Leptosphaeria maculans JN3] Length = 166 Score = 102 bits (254), Expect = 9e-25 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_007686870.1 hypothetical protein COCMIDRAFT_4335 [Bipolaris oryzae ATCC 44560] EUC46555.1 hypothetical protein COCMIDRAFT_4335 [Bipolaris oryzae ATCC 44560] Length = 222 Score = 102 bits (254), Expect = 3e-24 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 117 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 161 >XP_018390863.1 hypothetical protein CC77DRAFT_1016408 [Alternaria alternata] OAG25442.1 hypothetical protein CC77DRAFT_1016408 [Alternaria alternata] Length = 165 Score = 100 bits (249), Expect = 5e-24 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 137 KTRFSWQ+YYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP Sbjct: 56 KTRFSWQWYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSAPP 100 >XP_018035269.1 hypothetical protein CC84DRAFT_1165265 [Paraphaeosphaeria sporulosa] OAG04904.1 hypothetical protein CC84DRAFT_1165265 [Paraphaeosphaeria sporulosa] Length = 164 Score = 96.7 bits (239), Expect = 1e-22 Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQR+ APP Sbjct: 56 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRTHAPP 101 >XP_003014219.1 hypothetical protein ARB_07524 [Trichophyton benhamiae CBS 112371] XP_003025318.1 hypothetical protein TRV_00498 [Trichophyton verrucosum HKI 0517] EFE33579.1 hypothetical protein ARB_07524 [Trichophyton benhamiae CBS 112371] EFE44707.1 hypothetical protein TRV_00498 [Trichophyton verrucosum HKI 0517] Length = 129 Score = 95.5 bits (236), Expect = 2e-22 Identities = 44/46 (95%), Positives = 44/46 (95%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVP THIKQQRS APP Sbjct: 18 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPATHIKQQRSHAPP 63 >OCK74273.1 hypothetical protein K432DRAFT_259779, partial [Lepidopterella palustris CBS 459.81] Length = 166 Score = 96.3 bits (238), Expect = 2e-22 Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KT+FSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS APP Sbjct: 55 KTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 100 >XP_020132291.1 small subunit ribosomal protein s10e [Diplodia corticola] OJD36031.1 small subunit ribosomal protein s10e [Diplodia corticola] Length = 170 Score = 96.3 bits (238), Expect = 2e-22 Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KT+FSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS APP Sbjct: 65 KTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 110 >KKY13666.1 putative 40s ribosomal protein s10-a [Diplodia seriata] Length = 172 Score = 96.3 bits (238), Expect = 2e-22 Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KT+FSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS APP Sbjct: 67 KTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 112 >XP_007587847.1 putative 40s ribosomal protein s10-a protein [Neofusicoccum parvum UCRNP2] EOD44688.1 putative 40s ribosomal protein s10-a protein [Neofusicoccum parvum UCRNP2] Length = 178 Score = 96.3 bits (238), Expect = 3e-22 Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KT+FSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS APP Sbjct: 72 KTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 117 >OMP85478.1 40S ribosomal protein S10-B [Diplodia seriata] Length = 180 Score = 96.3 bits (238), Expect = 3e-22 Identities = 44/46 (95%), Positives = 45/46 (97%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KT+FSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS APP Sbjct: 75 KTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRSHAPP 120 >GAD93019.1 40S ribosomal protein S10-B, putative [Byssochlamys spectabilis No. 5] Length = 159 Score = 95.5 bits (236), Expect = 4e-22 Identities = 44/46 (95%), Positives = 44/46 (95%), Gaps = 1/46 (2%) Frame = +3 Query: 3 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPQTHIKQQRS-APP 137 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVP THIKQQRS APP Sbjct: 58 KTRFSWQYYYYTLTPEGLDYLREWLHLPAEIVPATHIKQQRSHAPP 103