BLASTX nr result
ID: Papaver32_contig00015621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00015621 (584 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010256793.1 PREDICTED: uncharacterized protein At2g39795, mit... 55 9e-06 >XP_010256793.1 PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Nelumbo nucifera] Length = 256 Score = 55.1 bits (131), Expect = 9e-06 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%) Frame = +2 Query: 341 SRMMKKAASSLIPLANRTVH-HRNYSSSIFTTPLKNCIXXXXXXGNLCRQIFPRTSIPTL 517 S ++++AAS+++PLA R + RNY SS+F + N +L + + RT +P L Sbjct: 4 STILRRAASTVVPLAVRAIGTQRNYHSSLFASLKSN---------SLSQDVCWRTFLPAL 54 Query: 518 NFSSQAKKKPSSDESLLGCLDD 583 NFSS AK+ PSSDE+LL ++D Sbjct: 55 NFSSAAKR-PSSDENLLRVIED 75