BLASTX nr result
ID: Papaver32_contig00014727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00014727 (1129 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK76546.1 uncharacterized protein A4U43_C03F29400 [Asparagus of... 60 3e-06 ONM25163.1 Tubulin gamma-2 chain [Zea mays] 56 5e-06 XP_016169231.1 PREDICTED: WD-40 repeat-containing protein MSI4-l... 59 6e-06 XP_015935418.1 PREDICTED: WD-40 repeat-containing protein MSI4-l... 59 8e-06 >ONK76546.1 uncharacterized protein A4U43_C03F29400 [Asparagus officinalis] Length = 484 Score = 60.1 bits (144), Expect = 3e-06 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 3/50 (6%) Frame = +3 Query: 291 VLRGGIGINLMEIDYSVPPRL---WCPDKASVFGSAAEDGFLNVWDHDKV 431 ++ G +G L + P L WCPDKASVFGSAAED FLNVWDH+KV Sbjct: 342 LISGAVGSPLHIFEGHTSPVLCVQWCPDKASVFGSAAEDSFLNVWDHEKV 391 >ONM25163.1 Tubulin gamma-2 chain [Zea mays] Length = 139 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 348 RLWCPDKASVFGSAAEDGFLNVWDHDKV 431 R W PD+ASVFGS+AEDGFLNVWDH+KV Sbjct: 46 RHWSPDRASVFGSSAEDGFLNVWDHEKV 73 >XP_016169231.1 PREDICTED: WD-40 repeat-containing protein MSI4-like [Arachis ipaensis] Length = 450 Score = 58.9 bits (141), Expect = 6e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +3 Query: 354 WCPDKASVFGSAAEDGFLNVWDHDKVTGRILSRHKWS 464 WCPDK+SVFGS+AEDGFLN+WDH+KV G+ H+ S Sbjct: 338 WCPDKSSVFGSSAEDGFLNIWDHEKV-GQTSGPHRAS 373 >XP_015935418.1 PREDICTED: WD-40 repeat-containing protein MSI4-like [Arachis duranensis] Length = 443 Score = 58.5 bits (140), Expect = 8e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = +3 Query: 354 WCPDKASVFGSAAEDGFLNVWDHDKV 431 WCPDK+SVFGS+AEDGFLN+WDH+KV Sbjct: 331 WCPDKSSVFGSSAEDGFLNIWDHEKV 356