BLASTX nr result
ID: Papaver32_contig00014122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00014122 (507 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AOF41064.1 thaumatin-like protein 2 [Castanea sativa] 144 5e-40 XP_018811059.1 PREDICTED: thaumatin-like protein 1a [Juglans regia] 141 4e-39 KNA17117.1 hypothetical protein SOVF_083130 [Spinacia oleracea] 139 9e-39 OIV92493.1 hypothetical protein TanjilG_02256 [Lupinus angustifo... 138 1e-38 XP_018805182.1 PREDICTED: thaumatin-like protein 1b [Juglans regia] 140 2e-38 XP_018840274.1 PREDICTED: thaumatin-like protein 1, partial [Jug... 137 3e-38 XP_018854736.1 PREDICTED: thaumatin-like protein 1, partial [Jug... 137 4e-38 GAV58933.1 Thaumatin domain-containing protein [Cephalotus folli... 139 5e-38 GAV85733.1 Thaumatin domain-containing protein [Cephalotus folli... 139 5e-38 KJB15105.1 hypothetical protein B456_002G160600 [Gossypium raimo... 138 6e-38 XP_010056283.1 PREDICTED: thaumatin-like protein 1 [Eucalyptus g... 139 8e-38 XP_018839417.1 PREDICTED: thaumatin-like protein 1b [Juglans regia] 139 9e-38 XP_010056279.1 PREDICTED: thaumatin-like protein 1 [Eucalyptus g... 138 1e-37 XP_019425007.1 PREDICTED: thaumatin-like protein 1 [Lupinus angu... 138 1e-37 ONI12048.1 hypothetical protein PRUPE_4G141100 [Prunus persica] 137 1e-37 XP_018850618.1 PREDICTED: thaumatin-like protein 1 [Juglans regia] 138 1e-37 XP_018805641.1 PREDICTED: thaumatin-like protein 1, partial [Jug... 137 2e-37 XP_015898569.1 PREDICTED: thaumatin-like protein 1b [Ziziphus ju... 137 2e-37 KDO39870.1 hypothetical protein CISIN_1g0260372mg, partial [Citr... 137 2e-37 XP_007211860.1 hypothetical protein PRUPE_ppa010031mg [Prunus pe... 137 3e-37 >AOF41064.1 thaumatin-like protein 2 [Castanea sativa] Length = 243 Score = 144 bits (363), Expect = 5e-40 Identities = 62/77 (80%), Positives = 68/77 (88%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 V+G+ GSV+ACKSAC AF QPQYCCTG+FNTP+TCPPT YSRIFK CPQAYSYAYDDST Sbjct: 167 VKGSDGSVLACKSACIAFNQPQYCCTGAFNTPKTCPPTKYSRIFKQQCPQAYSYAYDDST 226 Query: 186 STFTCAAGGNYVITFCP 236 STFTC+ NYVITFCP Sbjct: 227 STFTCSGAPNYVITFCP 243 >XP_018811059.1 PREDICTED: thaumatin-like protein 1a [Juglans regia] Length = 230 Score = 141 bits (356), Expect = 4e-39 Identities = 61/77 (79%), Positives = 66/77 (85%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 ++ A GSVIACKSAC AF QPQYCCTG+FNTPQTCPPTNYS IF+N CPQAYSYAYDD Sbjct: 154 LKAADGSVIACKSACTAFNQPQYCCTGNFNTPQTCPPTNYSMIFENQCPQAYSYAYDDVN 213 Query: 186 STFTCAAGGNYVITFCP 236 STFTC+ NYVITFCP Sbjct: 214 STFTCSGAPNYVITFCP 230 >KNA17117.1 hypothetical protein SOVF_083130 [Spinacia oleracea] Length = 198 Score = 139 bits (351), Expect = 9e-39 Identities = 60/78 (76%), Positives = 65/78 (83%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +VR + GS+I CKSAC AF QPQYCCTG + TPQTCPPTN SR FKN CPQAYSYAYDDS Sbjct: 121 AVRDSNGSIIGCKSACLAFNQPQYCCTGDYKTPQTCPPTNLSRYFKNQCPQAYSYAYDDS 180 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC G NY+ITFCP Sbjct: 181 TSTFTCPTGVNYLITFCP 198 >OIV92493.1 hypothetical protein TanjilG_02256 [Lupinus angustifolius] Length = 171 Score = 138 bits (348), Expect = 1e-38 Identities = 56/78 (71%), Positives = 68/78 (87%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +++G+ GSVI CKSAC A QPQYCCTG+FN P CPPTNYS+IFK+ CPQAYSYA+DD Sbjct: 94 ALKGSDGSVIGCKSACLALNQPQYCCTGAFNAPDKCPPTNYSKIFKDQCPQAYSYAFDDK 153 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC++GGNY++TFCP Sbjct: 154 TSTFTCSSGGNYLVTFCP 171 >XP_018805182.1 PREDICTED: thaumatin-like protein 1b [Juglans regia] Length = 245 Score = 140 bits (353), Expect = 2e-38 Identities = 60/77 (77%), Positives = 66/77 (85%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 ++ A GSVIACKSAC AF QPQYCCTG+FNTPQTCPPTNYS IF+N CPQAYSYAYDD Sbjct: 169 LKAADGSVIACKSACLAFNQPQYCCTGNFNTPQTCPPTNYSMIFENQCPQAYSYAYDDVN 228 Query: 186 STFTCAAGGNYVITFCP 236 STFTC+ NY+ITFCP Sbjct: 229 STFTCSGAPNYIITFCP 245 >XP_018840274.1 PREDICTED: thaumatin-like protein 1, partial [Juglans regia] Length = 165 Score = 137 bits (345), Expect = 3e-38 Identities = 56/78 (71%), Positives = 65/78 (83%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+G+ G VIACKSACEAF QPQYCC+G + P+ CPPT YS+IFK+ CPQAYSYAYDD Sbjct: 88 AVKGSNGEVIACKSACEAFNQPQYCCSGDYGVPERCPPTKYSKIFKDQCPQAYSYAYDDK 147 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC G NY+ITFCP Sbjct: 148 TSTFTCTGGANYLITFCP 165 >XP_018854736.1 PREDICTED: thaumatin-like protein 1, partial [Juglans regia] Length = 164 Score = 137 bits (344), Expect = 4e-38 Identities = 55/78 (70%), Positives = 65/78 (83%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+G+ G VIACKSACEAF QPQYCC+G + P+ CPPT YS+IFK+ CPQAYSYAYDD Sbjct: 87 AVKGSNGEVIACKSACEAFNQPQYCCSGDYGVPERCPPTKYSKIFKDQCPQAYSYAYDDK 146 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC G NY++TFCP Sbjct: 147 TSTFTCTGGANYLVTFCP 164 >GAV58933.1 Thaumatin domain-containing protein [Cephalotus follicularis] Length = 245 Score = 139 bits (350), Expect = 5e-38 Identities = 59/77 (76%), Positives = 66/77 (85%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 V+G+ G VIACKSAC+AF QPQYCCTG++NTP TCPPT+YS IFK CPQAYSYAYDDST Sbjct: 169 VKGSDGRVIACKSACDAFSQPQYCCTGAYNTPATCPPTSYSNIFKQQCPQAYSYAYDDST 228 Query: 186 STFTCAAGGNYVITFCP 236 STF+C NYVITFCP Sbjct: 229 STFSCTGSPNYVITFCP 245 >GAV85733.1 Thaumatin domain-containing protein [Cephalotus follicularis] Length = 246 Score = 139 bits (350), Expect = 5e-38 Identities = 59/77 (76%), Positives = 65/77 (84%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 VRG GSVI CKSAC+AF +PQYCCTG++NTP TCPPT+YS IFK CPQAYSYAYDDST Sbjct: 170 VRGPDGSVIGCKSACDAFNEPQYCCTGAYNTPATCPPTSYSNIFKQQCPQAYSYAYDDST 229 Query: 186 STFTCAAGGNYVITFCP 236 STF+C NYVITFCP Sbjct: 230 STFSCTGSPNYVITFCP 246 >KJB15105.1 hypothetical protein B456_002G160600 [Gossypium raimondii] Length = 230 Score = 138 bits (348), Expect = 6e-38 Identities = 57/77 (74%), Positives = 66/77 (85%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 V+G GG VIACKSAC AF+QPQYCCTG++N+P TC PT YS+IFK+ CPQAYSYAYDD T Sbjct: 154 VKGLGGGVIACKSACLAFKQPQYCCTGAYNSPATCQPTKYSKIFKSQCPQAYSYAYDDKT 213 Query: 186 STFTCAAGGNYVITFCP 236 STFTC G NY++TFCP Sbjct: 214 STFTCTGGANYLVTFCP 230 >XP_010056283.1 PREDICTED: thaumatin-like protein 1 [Eucalyptus grandis] KCW72945.1 hypothetical protein EUGRSUZ_E01389 [Eucalyptus grandis] Length = 249 Score = 139 bits (349), Expect = 8e-38 Identities = 56/78 (71%), Positives = 70/78 (89%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+G+ GS++ACKSAC A QPQYCCTG++NTP TCPPTNYS+IFK+ CPQAYSYAYDD+ Sbjct: 172 AVKGSDGSIVACKSACLALNQPQYCCTGAYNTPATCPPTNYSKIFKDQCPQAYSYAYDDT 231 Query: 183 TSTFTCAAGGNYVITFCP 236 +STF+CA G +Y+ITFCP Sbjct: 232 SSTFSCAGGASYLITFCP 249 >XP_018839417.1 PREDICTED: thaumatin-like protein 1b [Juglans regia] Length = 270 Score = 139 bits (350), Expect = 9e-38 Identities = 60/77 (77%), Positives = 66/77 (85%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 V+ GSVIACKSAC AF QPQYCCTG+FNTP +CPPTNYSRIFK+ CPQAYSYAYDD+ Sbjct: 194 VKDGNGSVIACKSACIAFNQPQYCCTGNFNTPVSCPPTNYSRIFKDQCPQAYSYAYDDAN 253 Query: 186 STFTCAAGGNYVITFCP 236 STFTC+ NYVITFCP Sbjct: 254 STFTCSGAPNYVITFCP 270 >XP_010056279.1 PREDICTED: thaumatin-like protein 1 [Eucalyptus grandis] XP_010056280.1 PREDICTED: thaumatin-like protein 1 [Eucalyptus grandis] KCW72941.1 hypothetical protein EUGRSUZ_E01382 [Eucalyptus grandis] KCW72942.1 hypothetical protein EUGRSUZ_E01384 [Eucalyptus grandis] Length = 249 Score = 138 bits (348), Expect = 1e-37 Identities = 56/78 (71%), Positives = 70/78 (89%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+G+ GS++ACKSAC A QPQYCCTG++NTP TCPPTNYS+IFK+ CPQAYSYAYDD+ Sbjct: 172 AVKGSDGSIVACKSACLALNQPQYCCTGAYNTPATCPPTNYSQIFKDQCPQAYSYAYDDT 231 Query: 183 TSTFTCAAGGNYVITFCP 236 +STF+CA G +Y+ITFCP Sbjct: 232 SSTFSCAGGASYLITFCP 249 >XP_019425007.1 PREDICTED: thaumatin-like protein 1 [Lupinus angustifolius] Length = 251 Score = 138 bits (348), Expect = 1e-37 Identities = 56/78 (71%), Positives = 68/78 (87%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +++G+ GSVI CKSAC A QPQYCCTG+FN P CPPTNYS+IFK+ CPQAYSYA+DD Sbjct: 174 ALKGSDGSVIGCKSACLALNQPQYCCTGAFNAPDKCPPTNYSKIFKDQCPQAYSYAFDDK 233 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC++GGNY++TFCP Sbjct: 234 TSTFTCSSGGNYLVTFCP 251 >ONI12048.1 hypothetical protein PRUPE_4G141100 [Prunus persica] Length = 226 Score = 137 bits (346), Expect = 1e-37 Identities = 58/78 (74%), Positives = 65/78 (83%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 SV+G+ GSVI CKSAC A QPQYCCTG++ +P TCPPTNYS+IFKN CPQAYSYAYDD Sbjct: 149 SVKGSDGSVIGCKSACMALNQPQYCCTGAYGSPDTCPPTNYSKIFKNQCPQAYSYAYDDK 208 Query: 183 TSTFTCAAGGNYVITFCP 236 +STFTC G NY ITFCP Sbjct: 209 SSTFTCFGGPNYAITFCP 226 >XP_018850618.1 PREDICTED: thaumatin-like protein 1 [Juglans regia] Length = 245 Score = 138 bits (347), Expect = 1e-37 Identities = 58/77 (75%), Positives = 63/77 (81%) Frame = +3 Query: 6 VRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDST 185 V+G GSV+ACKSAC AF QPQYCCTG FNTP CPPTNYS IF+ CPQAYSYAYDD Sbjct: 169 VKGPDGSVLACKSACTAFNQPQYCCTGDFNTPDKCPPTNYSMIFEKQCPQAYSYAYDDQN 228 Query: 186 STFTCAAGGNYVITFCP 236 STFTC+ G NY+ITFCP Sbjct: 229 STFTCSGGPNYIITFCP 245 >XP_018805641.1 PREDICTED: thaumatin-like protein 1, partial [Juglans regia] Length = 228 Score = 137 bits (345), Expect = 2e-37 Identities = 56/78 (71%), Positives = 65/78 (83%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+G+ G VIACKSACEAF QPQYCC+G + P+ CPPT YS+IFK+ CPQAYSYAYDD Sbjct: 151 AVKGSNGEVIACKSACEAFNQPQYCCSGDYGVPERCPPTKYSKIFKDQCPQAYSYAYDDK 210 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC G NY+ITFCP Sbjct: 211 TSTFTCTGGANYLITFCP 228 >XP_015898569.1 PREDICTED: thaumatin-like protein 1b [Ziziphus jujuba] Length = 243 Score = 137 bits (346), Expect = 2e-37 Identities = 59/78 (75%), Positives = 67/78 (85%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+ A G VIACKSAC A QPQYCCTG+F+ P+TCPPT+YSRIFKN CPQAYSYAYDD Sbjct: 166 AVKAADGRVIACKSACLALNQPQYCCTGNFDRPETCPPTDYSRIFKNQCPQAYSYAYDDK 225 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTFTC +G NY+ITFCP Sbjct: 226 TSTFTCFSGPNYLITFCP 243 >KDO39870.1 hypothetical protein CISIN_1g0260372mg, partial [Citrus sinensis] Length = 226 Score = 137 bits (344), Expect = 2e-37 Identities = 57/78 (73%), Positives = 67/78 (85%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 +V+G+ G+VIACKSAC AF +PQYCCTG+FN P+TCPPT YS+IFK+ CPQAYSYAYDD Sbjct: 149 AVKGSDGNVIACKSACAAFNEPQYCCTGAFNKPETCPPTKYSKIFKDQCPQAYSYAYDDR 208 Query: 183 TSTFTCAAGGNYVITFCP 236 TSTF+C G NY ITFCP Sbjct: 209 TSTFSCTGGPNYDITFCP 226 >XP_007211860.1 hypothetical protein PRUPE_ppa010031mg [Prunus persica] Length = 267 Score = 137 bits (346), Expect = 3e-37 Identities = 58/78 (74%), Positives = 65/78 (83%) Frame = +3 Query: 3 SVRGAGGSVIACKSACEAFRQPQYCCTGSFNTPQTCPPTNYSRIFKNACPQAYSYAYDDS 182 SV+G+ GSVI CKSAC A QPQYCCTG++ +P TCPPTNYS+IFKN CPQAYSYAYDD Sbjct: 190 SVKGSDGSVIGCKSACMALNQPQYCCTGAYGSPDTCPPTNYSKIFKNQCPQAYSYAYDDK 249 Query: 183 TSTFTCAAGGNYVITFCP 236 +STFTC G NY ITFCP Sbjct: 250 SSTFTCFGGPNYAITFCP 267