BLASTX nr result
ID: Papaver32_contig00012949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00012949 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233666.1 PREDICTED: uncharacterized protein LOC108207746 [... 57 8e-07 >XP_017233666.1 PREDICTED: uncharacterized protein LOC108207746 [Daucus carota subsp. sativus] KZN06934.1 hypothetical protein DCAR_007771 [Daucus carota subsp. sativus] Length = 331 Score = 57.0 bits (136), Expect = 8e-07 Identities = 24/46 (52%), Positives = 38/46 (82%) Frame = +2 Query: 287 MGFLAIYKEAYKLTAFNKKIFLQITSTILFPLAIFYLSEIQISNFI 424 +GFL I+KEA+ +T+ ++KIF QIT TI+ PL++FYL++I+IS + Sbjct: 11 LGFLGIFKEAFSVTSSHRKIFSQITLTIILPLSLFYLAQIEISEIL 56