BLASTX nr result
ID: Papaver32_contig00012219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00012219 (540 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002885266.1 hypothetical protein ARALYDRAFT_479366 [Arabidops... 52 8e-07 >XP_002885266.1 hypothetical protein ARALYDRAFT_479366 [Arabidopsis lyrata subsp. lyrata] EFH61525.1 hypothetical protein ARALYDRAFT_479366 [Arabidopsis lyrata subsp. lyrata] Length = 564 Score = 51.6 bits (122), Expect(2) = 8e-07 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 4/44 (9%) Frame = +1 Query: 421 DFFKQAGKINDVRFSRY----FRGTCHIEFASEEGAKKAAELNG 540 +FFK+AG++ DVRFS Y F+G H+EFAS E A+KA ELNG Sbjct: 331 NFFKEAGEVVDVRFSSYDDGTFKGYGHVEFASPEEAQKALELNG 374 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 351 TTGASKTLVAKNLSFSTTKSDV 416 T G SKTL A NLSF +SD+ Sbjct: 308 TQGGSKTLFAGNLSFQIKRSDI 329