BLASTX nr result
ID: Papaver32_contig00012088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00012088 (1223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OEL26885.1 40S ribosomal protein S30, partial [Dichanthelium oli... 57 3e-07 XP_009766159.1 PREDICTED: 40S ribosomal protein S30-like [Nicoti... 57 5e-07 BAK06364.1 predicted protein, partial [Hordeum vulgare subsp. vu... 56 8e-07 CDY21649.1 BnaA09g44000D [Brassica napus] 55 2e-06 KOM44808.1 hypothetical protein LR48_Vigan06g011400, partial [Vi... 55 2e-06 KZN06765.1 hypothetical protein DCAR_007602 [Daucus carota subsp... 55 2e-06 KYP67165.1 40S ribosomal protein S30 [Cajanus cajan] 55 2e-06 OEL34214.1 hypothetical protein BAE44_0004765, partial [Dichanth... 55 2e-06 KOM32579.1 hypothetical protein LR48_Vigan01g213500 [Vigna angul... 55 2e-06 GAV81518.1 Ribosomal_S30 domain-containing protein, partial [Cep... 55 2e-06 OEL35698.1 40S ribosomal protein S30, partial [Dichanthelium oli... 55 2e-06 XP_016540388.1 PREDICTED: 40S ribosomal protein S30-like [Capsic... 55 2e-06 XP_003608708.1 40S ribosomal S30-like protein [Medicago truncatu... 55 2e-06 NP_001149323.1 uncharacterized protein LOC100282946 [Zea mays] X... 55 2e-06 NP_194668.1 Ribosomal protein S30 family protein [Arabidopsis th... 55 2e-06 XP_009799526.1 PREDICTED: 40S ribosomal protein S30-like [Nicoti... 55 2e-06 XP_008375203.1 PREDICTED: 40S ribosomal protein S30 [Malus domes... 55 2e-06 XP_006412846.1 hypothetical protein EUTSA_v10026738mg [Eutrema s... 55 2e-06 XP_006408892.1 hypothetical protein EUTSA_v10002144mg [Eutrema s... 55 2e-06 XP_006858925.1 PREDICTED: 40S ribosomal protein S30 [Amborella t... 55 2e-06 >OEL26885.1 40S ribosomal protein S30, partial [Dichanthelium oligosanthes] Length = 63 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 753 GSGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 G+GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 1 GAGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 37 >XP_009766159.1 PREDICTED: 40S ribosomal protein S30-like [Nicotiana sylvestris] XP_016508997.1 PREDICTED: 40S ribosomal protein S30-like [Nicotiana tabacum] Length = 62 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KVTKQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVTKQDKKKKPRGRAHK 36 >BAK06364.1 predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 69 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 756 SGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 SGKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 8 SGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHK 43 >CDY21649.1 BnaA09g44000D [Brassica napus] Length = 63 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 756 SGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 +GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 AGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 37 >KOM44808.1 hypothetical protein LR48_Vigan06g011400, partial [Vigna angularis] Length = 64 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 756 SGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 +GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 3 AGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 38 >KZN06765.1 hypothetical protein DCAR_007602 [Daucus carota subsp. sativus] Length = 52 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >KYP67165.1 40S ribosomal protein S30 [Cajanus cajan] Length = 65 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 756 SGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 +GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 4 AGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 39 >OEL34214.1 hypothetical protein BAE44_0004765, partial [Dichanthelium oligosanthes] Length = 66 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 756 SGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 +GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 5 AGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 40 >KOM32579.1 hypothetical protein LR48_Vigan01g213500 [Vigna angularis] Length = 71 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 756 SGKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 +GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 10 TGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 45 >GAV81518.1 Ribosomal_S30 domain-containing protein, partial [Cephalotus follicularis] Length = 61 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 1 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 35 >OEL35698.1 40S ribosomal protein S30, partial [Dichanthelium oligosanthes] Length = 61 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 1 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 35 >XP_016540388.1 PREDICTED: 40S ribosomal protein S30-like [Capsicum annuum] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >XP_003608708.1 40S ribosomal S30-like protein [Medicago truncatula] XP_003611308.1 40S ribosomal S30-like protein [Medicago truncatula] AES90905.1 40S ribosomal S30-like protein [Medicago truncatula] AES94266.1 40S ribosomal S30-like protein [Medicago truncatula] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHK 36 >NP_001149323.1 uncharacterized protein LOC100282946 [Zea mays] XP_002318077.1 40S ribosomal protein S30 [Populus trichocarpa] XP_002322202.1 40S ribosomal protein S30 [Populus trichocarpa] XP_002281376.1 PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] XP_002283033.1 PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] XP_002454730.1 hypothetical protein SORBIDRAFT_04g036360 [Sorghum bicolor] XP_002436569.1 hypothetical protein SORBIDRAFT_10g004940 [Sorghum bicolor] XP_002514177.1 PREDICTED: 40S ribosomal protein S30 [Ricinus communis] XP_002515895.1 PREDICTED: 40S ribosomal protein S30 [Ricinus communis] XP_003517420.1 PREDICTED: 40S ribosomal protein S30 [Glycine max] XP_003525848.1 PREDICTED: 40S ribosomal protein S30 [Glycine max] XP_003538817.1 PREDICTED: 40S ribosomal protein S30 [Glycine max] XP_004135684.1 PREDICTED: 40S ribosomal protein S30 [Cucumis sativus] XP_004141043.1 PREDICTED: 40S ribosomal protein S30 [Cucumis sativus] XP_004251654.1 PREDICTED: 40S ribosomal protein S30 [Solanum lycopersicum] XP_004287748.1 PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] XP_004297622.1 PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] XP_004508905.1 PREDICTED: 40S ribosomal protein S30 [Cicer arietinum] XP_004511685.1 PREDICTED: 40S ribosomal protein S30 [Cicer arietinum] XP_006352915.1 PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] XP_006353513.1 PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] XP_006475373.1 PREDICTED: 40S ribosomal protein S30 [Citrus sinensis] XP_006853921.1 PREDICTED: 40S ribosomal protein S30 [Amborella trichopoda] XP_007024390.1 PREDICTED: 40S ribosomal protein S30 [Theobroma cacao] XP_007155660.1 hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] XP_007157355.1 hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] XP_007215235.1 hypothetical protein PRUPE_ppa014539mg [Prunus persica] XP_008241983.1 PREDICTED: 40S ribosomal protein S30 [Prunus mume] XP_008244746.1 PREDICTED: 40S ribosomal protein S30 [Prunus mume] XP_008459180.1 PREDICTED: 40S ribosomal protein S30 [Cucumis melo] XP_008450806.1 PREDICTED: 40S ribosomal protein S30 [Cucumis melo] XP_009624349.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] XP_009626192.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] XP_009588124.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] XP_009794298.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] XP_009790332.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] XP_010267071.1 PREDICTED: 40S ribosomal protein S30 [Nelumbo nucifera] XP_004245996.2 PREDICTED: 40S ribosomal protein S30 [Solanum lycopersicum] XP_011040498.1 PREDICTED: 40S ribosomal protein S30 [Populus euphratica] XP_011014917.1 PREDICTED: 40S ribosomal protein S30 [Populus euphratica] XP_011085776.1 PREDICTED: 40S ribosomal protein S30 [Sesamum indicum] XP_011093674.1 PREDICTED: 40S ribosomal protein S30 [Sesamum indicum] XP_012076815.1 PREDICTED: 40S ribosomal protein S30 [Jatropha curcas] XP_012831909.1 PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] XP_012845561.1 PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] XP_014507978.1 PREDICTED: 40S ribosomal protein S30 [Vigna radiata var. radiata] XP_014520643.1 PREDICTED: 40S ribosomal protein S30 [Vigna radiata var. radiata] XP_015083483.1 PREDICTED: 40S ribosomal protein S30 [Solanum pennellii] XP_015059382.1 PREDICTED: 40S ribosomal protein S30 [Solanum pennellii] XP_015623731.1 PREDICTED: 40S ribosomal protein S30 [Oryza sativa Japonica Group] XP_015644441.1 PREDICTED: 40S ribosomal protein S30 [Oryza sativa Japonica Group] XP_015866631.1 PREDICTED: 40S ribosomal protein S30 [Ziziphus jujuba] XP_015962015.1 PREDICTED: 40S ribosomal protein S30 [Arachis duranensis] XP_015964426.1 PREDICTED: 40S ribosomal protein S30 [Arachis duranensis] XP_016188282.1 PREDICTED: 40S ribosomal protein S30 [Arachis ipaensis] XP_016200666.1 PREDICTED: 40S ribosomal protein S30 [Arachis ipaensis] XP_016474572.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016480718.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016485434.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016507476.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016438944.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016571468.1 PREDICTED: 40S ribosomal protein S30 [Capsicum annuum] XP_017235880.1 PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] XP_017240313.1 PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] XP_017428506.1 PREDICTED: 40S ribosomal protein S30 [Vigna angularis] XP_017426528.1 PREDICTED: 40S ribosomal protein S30 [Vigna angularis] XP_018843304.1 PREDICTED: 40S ribosomal protein S30 [Juglans regia] XP_018843305.1 PREDICTED: 40S ribosomal protein S30 [Juglans regia] XP_018809943.1 PREDICTED: 40S ribosomal protein S30 [Juglans regia] XP_019056958.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019058004.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019058091.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019058590.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019249645.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] XP_019246883.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] XP_019254765.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] 3J60_EE Chain e, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome BAD19414.1 40S ribosomal protein S30-like [Oryza sativa Japonica Group] BAD36047.1 40S ribosomal protein S30-like [Oryza sativa Japonica Group] BAD72277.1 40S ribosomal protein S30-like [Oryza sativa Japonica Group] BAF18855.1 Os06g0172600 [Oryza sativa Japonica Group] ABK93031.1 unknown [Populus trichocarpa] ABK93458.1 unknown [Populus trichocarpa] ABK93562.1 unknown [Populus trichocarpa] ABK93960.1 unknown [Populus trichocarpa] ABK94037.1 unknown [Populus trichocarpa] ABK95737.1 unknown [Populus trichocarpa] ACG25714.1 40S ribosomal protein S30 [Zea mays] ACG26835.1 40S ribosomal protein S30 [Zea mays] ACG29907.1 40S ribosomal protein S30 [Zea mays] ACG30825.1 40S ribosomal protein S30 [Zea mays] ACG31062.1 40S ribosomal protein S30 [Zea mays] ACG31470.1 40S ribosomal protein S30 [Zea mays] ACG35021.1 40S ribosomal protein S30 [Zea mays] ACG39400.1 40S ribosomal protein S30 [Zea mays] EEE96297.1 40S ribosomal protein S30 [Populus trichocarpa] EEF06329.1 40S ribosomal protein S30 [Populus trichocarpa] EEF46315.1 40S ribosomal protein S30, putative [Ricinus communis] EEF48131.1 40S ribosomal protein S30, putative [Ricinus communis] EER87936.1 hypothetical protein SORBI_010G057100 [Sorghum bicolor] EES07706.1 hypothetical protein SORBI_004G335600 [Sorghum bicolor] ACU20293.1 unknown [Glycine max] AFK44345.1 unknown [Lotus japonicus] AFK48101.1 unknown [Lotus japonicus] AGL08206.1 40s ribosomal protein S30 [Arachis hypogaea] EOY27012.1 Ribosomal protein S30 family protein [Theobroma cacao] ERN15388.1 hypothetical protein AMTR_s00036p00192320 [Amborella trichopoda] ESW27654.1 hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] ESW29349.1 hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] EYU30668.1 hypothetical protein MIMGU_mgv1a017625mg [Erythranthe guttata] EYU30669.1 hypothetical protein MIMGU_mgv1a017625mg [Erythranthe guttata] AHY23246.1 hypothetical protein [Fallopia multiflora] KDP33759.1 hypothetical protein JCGZ_07330 [Jatropha curcas] KGN66198.1 hypothetical protein Csa_1G575140 [Cucumis sativus] KHN09823.1 40S ribosomal protein S30 [Glycine soja] KHN34938.1 40S ribosomal protein S30 [Glycine soja] KHN44070.1 40S ribosomal protein S30 [Glycine soja] BAS81446.1 Os02g0804100 [Oryza sativa Japonica Group] BAS96392.1 Os06g0172600 [Oryza sativa Japonica Group] KRH57406.1 hypothetical protein GLYMA_05G059600 [Glycine max] GAU29334.1 hypothetical protein TSUD_227050 [Trifolium subterraneum] GAU27826.1 hypothetical protein TSUD_114060 [Trifolium subterraneum] GAU24499.1 hypothetical protein TSUD_156110 [Trifolium subterraneum] ONH97228.1 hypothetical protein PRUPE_7G177900 [Prunus persica] ONI15656.1 hypothetical protein PRUPE_3G053900 [Prunus persica] AQK75890.1 40S ribosomal protein S30 [Zea mays] AQK84073.1 40S ribosomal protein S30 [Zea mays] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >NP_194668.1 Ribosomal protein S30 family protein [Arabidopsis thaliana] NP_200478.1 Ribosomal protein S30 family protein [Arabidopsis thaliana] NP_565458.1 Ribosomal protein S30 family protein [Arabidopsis thaliana] XP_002866160.1 40S ribosomal protein S30 [Arabidopsis lyrata subsp. lyrata] XP_002867411.1 predicted protein [Arabidopsis lyrata subsp. lyrata] XP_002886023.1 40S ribosomal protein S30 [Arabidopsis lyrata subsp. lyrata] XP_009128774.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_009128798.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_009126927.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_009132190.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_009102140.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_009112625.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_009120178.1 PREDICTED: 40S ribosomal protein S30 [Brassica rapa] XP_013596943.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013626457.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013596056.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013599982.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013606247.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013609902.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013614650.1 PREDICTED: 40S ribosomal protein S30 [Brassica oleracea var. oleracea] XP_013681480.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013668089.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013714327.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013732699.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013747240.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013664456.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013667002.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013667003.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013669799.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013671717.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013675154.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013682770.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013725359.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013729129.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_013732488.1 PREDICTED: 40S ribosomal protein S30 [Brassica napus] XP_018449638.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018469345.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018470110.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018471302.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018476207.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018436939.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018440305.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018454827.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018457820.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_018466394.1 PREDICTED: 40S ribosomal protein S30 [Raphanus sativus] XP_019098121.1 PREDICTED: 40S ribosomal protein S30 [Camelina sativa] XP_019089662.1 PREDICTED: 40S ribosomal protein S30 [Camelina sativa] XP_019096683.1 PREDICTED: 40S ribosomal protein S30 [Camelina sativa] P49689.3 RecName: Full=40S ribosomal protein S30 CAB79697.1 RIBOSOMAL PROTEIN S30 homolog [Arabidopsis thaliana] BAB09885.1 40S ribosomal protein S30 homolog [Arabidopsis thaliana] AAK96533.1 At2g19750/F6F22.22 [Arabidopsis thaliana] AAL31237.1 At2g19750/F6F22.22 [Arabidopsis thaliana] AAC62141.2 40S ribosomal protein S30 [Arabidopsis thaliana] AAM67081.1 40S ribosomal protein S30 [Arabidopsis thaliana] AAM91564.1 40S ribosomal protein S30-like protein [Arabidopsis thaliana] AAP21311.1 At5g56670 [Arabidopsis thaliana] BAE98431.1 ribosomal protein S30 homolog [Arabidopsis thaliana] EFH42419.1 40S ribosomal protein S30 [Arabidopsis lyrata subsp. lyrata] EFH43670.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH62282.1 40S ribosomal protein S30 [Arabidopsis lyrata subsp. lyrata] AEC06922.1 Ribosomal protein S30 family protein [Arabidopsis thaliana] AED96794.1 Ribosomal protein S30 family protein [Arabidopsis thaliana] AEE85625.1 Ribosomal protein S30 family protein [Arabidopsis thaliana] KFK40338.1 hypothetical protein AALP_AA3G361200 [Arabis alpina] CDY48722.1 BnaA09g09970D [Brassica napus] CDY03346.1 BnaC09g10020D [Brassica napus] OAO94242.1 hypothetical protein AXX17_AT5G55870 [Arabidopsis thaliana] OAO99485.1 hypothetical protein AXX17_AT4G33770 [Arabidopsis thaliana] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >XP_009799526.1 PREDICTED: 40S ribosomal protein S30-like [Nicotiana sylvestris] XP_016463372.1 PREDICTED: 40S ribosomal protein S30-like [Nicotiana tabacum] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >XP_008375203.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008380830.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008381137.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008387171.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008391295.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008337951.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008344217.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008346709.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008352418.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008354614.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_008367943.1 PREDICTED: 40S ribosomal protein S30 [Malus domestica] XP_009355222.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] XP_009367504.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] XP_009337091.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] XP_009338138.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] XP_009344421.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] XP_009344804.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] XP_009347178.1 PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >XP_006412846.1 hypothetical protein EUTSA_v10026738mg [Eutrema salsugineum] XP_019086736.1 PREDICTED: 40S ribosomal protein S30-like [Camelina sativa] XP_019096052.1 PREDICTED: 40S ribosomal protein S30-like [Camelina sativa] ESQ54299.1 hypothetical protein EUTSA_v10026738mg [Eutrema salsugineum] KFK27233.1 hypothetical protein AALP_AA8G354800 [Arabis alpina] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36 >XP_006408892.1 hypothetical protein EUTSA_v10002144mg [Eutrema salsugineum] ESQ50345.1 hypothetical protein EUTSA_v10002144mg [Eutrema salsugineum] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHK 36 >XP_006858925.1 PREDICTED: 40S ribosomal protein S30 [Amborella trichopoda] ERN20392.1 hypothetical protein AMTR_s00068p00064720 [Amborella trichopoda] Length = 62 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 759 GKVRGYLARAGEVRGQTSKVTKQSKNKNPRGKAHR 863 GKV G LARAG+VRGQT KV KQ K K PRG+AH+ Sbjct: 2 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36