BLASTX nr result
ID: Papaver32_contig00011361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00011361 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT55379.1 Chaperone protein DnaK, partial [Anthurium amnicola] 70 2e-11 XP_017699721.1 PREDICTED: coiled-coil domain-containing protein ... 68 6e-11 XP_010097351.1 hypothetical protein L484_010229 [Morus notabilis... 68 1e-10 XP_010247124.1 PREDICTED: coiled-coil domain-containing protein ... 68 1e-10 KCW61705.1 hypothetical protein EUGRSUZ_H04425 [Eucalyptus grandis] 67 1e-10 XP_019197643.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_019197642.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_019197641.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_019197640.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_019197639.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_019197638.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_019197637.1 PREDICTED: coiled-coil domain-containing protein ... 68 2e-10 XP_020113658.1 coiled-coil domain-containing protein SCD2-like i... 67 2e-10 XP_020113657.1 coiled-coil domain-containing protein SCD2-like i... 67 2e-10 XP_012089161.1 PREDICTED: coiled-coil domain-containing protein ... 67 3e-10 KDP23593.1 hypothetical protein JCGZ_23426 [Jatropha curcas] 67 3e-10 XP_010025105.1 PREDICTED: coiled-coil domain-containing protein ... 67 4e-10 XP_010025106.2 PREDICTED: coiled-coil domain-containing protein ... 67 4e-10 XP_018716822.1 PREDICTED: coiled-coil domain-containing protein ... 67 4e-10 XP_010904828.1 PREDICTED: coiled-coil domain-containing protein ... 66 5e-10 >JAT55379.1 Chaperone protein DnaK, partial [Anthurium amnicola] Length = 501 Score = 70.5 bits (171), Expect = 2e-11 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYWKLC+Q G+H+EIAE+RHEYW Sbjct: 410 VVLKRCWLARYWKLCVQFGIHSEIAETRHEYW 441 >XP_017699721.1 PREDICTED: coiled-coil domain-containing protein SCD2-like [Phoenix dactylifera] Length = 286 Score = 68.2 bits (165), Expect = 6e-11 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYWKLC+ +G+HA++AE++HEYW Sbjct: 59 VVLKRCWLARYWKLCVSYGIHADVAETKHEYW 90 >XP_010097351.1 hypothetical protein L484_010229 [Morus notabilis] EXB67661.1 hypothetical protein L484_010229 [Morus notabilis] Length = 729 Score = 68.2 bits (165), Expect = 1e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HAEIA++R+EYW Sbjct: 498 VVLKRCWLARYWSLCVEHGIHAEIAKARYEYW 529 >XP_010247124.1 PREDICTED: coiled-coil domain-containing protein SCD2-like, partial [Nelumbo nucifera] Length = 344 Score = 67.8 bits (164), Expect = 1e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HAEIA ++HEYW Sbjct: 111 VVLKRCWLARYWNLCVRHGIHAEIAGAKHEYW 142 >KCW61705.1 hypothetical protein EUGRSUZ_H04425 [Eucalyptus grandis] Length = 233 Score = 66.6 bits (161), Expect = 1e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LCI++G+HAEIAE++HE+W Sbjct: 4 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHW 35 >XP_019197643.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X7 [Ipomoea nil] Length = 498 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 276 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 307 >XP_019197642.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X6 [Ipomoea nil] Length = 600 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 378 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 409 >XP_019197641.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X5 [Ipomoea nil] Length = 615 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 393 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 424 >XP_019197640.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X4 [Ipomoea nil] Length = 622 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 434 >XP_019197639.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X3 [Ipomoea nil] Length = 623 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 434 >XP_019197638.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X2 [Ipomoea nil] Length = 624 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 434 >XP_019197637.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X1 [Ipomoea nil] Length = 625 Score = 67.8 bits (164), Expect = 2e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC++HG+HA+IAE +HEYW Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYW 434 >XP_020113658.1 coiled-coil domain-containing protein SCD2-like isoform X2 [Ananas comosus] Length = 556 Score = 67.4 bits (163), Expect = 2e-10 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYWKLC+ HG+HA+IAE +H YW Sbjct: 328 VVLKRCWLARYWKLCVNHGIHADIAEVKHAYW 359 >XP_020113657.1 coiled-coil domain-containing protein SCD2-like isoform X1 [Ananas comosus] Length = 560 Score = 67.4 bits (163), Expect = 2e-10 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYWKLC+ HG+HA+IAE +H YW Sbjct: 332 VVLKRCWLARYWKLCVNHGIHADIAEVKHAYW 363 >XP_012089161.1 PREDICTED: coiled-coil domain-containing protein SCD2-like [Jatropha curcas] Length = 653 Score = 67.0 bits (162), Expect = 3e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC+QHG+HAEIA +++EYW Sbjct: 430 VVLKRCWLARYWSLCVQHGIHAEIAGAKYEYW 461 >KDP23593.1 hypothetical protein JCGZ_23426 [Jatropha curcas] Length = 787 Score = 67.0 bits (162), Expect = 3e-10 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LC+QHG+HAEIA +++EYW Sbjct: 427 VVLKRCWLARYWSLCVQHGIHAEIAGAKYEYW 458 >XP_010025105.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X3 [Eucalyptus grandis] Length = 673 Score = 66.6 bits (161), Expect = 4e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LCI++G+HAEIAE++HE+W Sbjct: 444 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHW 475 >XP_010025106.2 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X2 [Eucalyptus grandis] Length = 677 Score = 66.6 bits (161), Expect = 4e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LCI++G+HAEIAE++HE+W Sbjct: 448 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHW 479 >XP_018716822.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X1 [Eucalyptus grandis] Length = 678 Score = 66.6 bits (161), Expect = 4e-10 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYW LCI++G+HAEIAE++HE+W Sbjct: 449 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHW 480 >XP_010904828.1 PREDICTED: coiled-coil domain-containing protein SCD2-like [Elaeis guineensis] Length = 510 Score = 66.2 bits (160), Expect = 5e-10 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +3 Query: 3 VVLKRCWLARYWKLCIQHGVHAEIAESRHEYW 98 VVLKRCWLARYWKLC+ +G+HA++AE++HE+W Sbjct: 284 VVLKRCWLARYWKLCVNYGIHADVAETKHEHW 315