BLASTX nr result
ID: Papaver32_contig00011360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00011360 (620 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT55379.1 Chaperone protein DnaK, partial [Anthurium amnicola] 70 1e-10 XP_017699721.1 PREDICTED: coiled-coil domain-containing protein ... 68 3e-10 XP_010247124.1 PREDICTED: coiled-coil domain-containing protein ... 68 6e-10 XP_010097351.1 hypothetical protein L484_010229 [Morus notabilis... 68 7e-10 XP_020113658.1 coiled-coil domain-containing protein SCD2-like i... 67 1e-09 XP_020113657.1 coiled-coil domain-containing protein SCD2-like i... 67 1e-09 KCW61705.1 hypothetical protein EUGRSUZ_H04425 [Eucalyptus grandis] 66 1e-09 XP_019197643.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_010904828.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_019197642.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_019197641.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_019197640.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_019197639.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_019197638.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_019197637.1 PREDICTED: coiled-coil domain-containing protein ... 66 3e-09 XP_010025105.1 PREDICTED: coiled-coil domain-containing protein ... 66 4e-09 XP_010025106.2 PREDICTED: coiled-coil domain-containing protein ... 66 4e-09 XP_018716822.1 PREDICTED: coiled-coil domain-containing protein ... 66 4e-09 XP_012089161.1 PREDICTED: coiled-coil domain-containing protein ... 65 6e-09 KDP23593.1 hypothetical protein JCGZ_23426 [Jatropha curcas] 65 6e-09 >JAT55379.1 Chaperone protein DnaK, partial [Anthurium amnicola] Length = 501 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYWKLCVQ G+H+EIAE+RHEYWSSL Sbjct: 410 VVLKRCWLARYWKLCVQFGIHSEIAETRHEYWSSL 444 >XP_017699721.1 PREDICTED: coiled-coil domain-containing protein SCD2-like [Phoenix dactylifera] Length = 286 Score = 68.2 bits (165), Expect = 3e-10 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYWKLCV +G+HA++AE++HEYWSSL Sbjct: 59 VVLKRCWLARYWKLCVSYGIHADVAETKHEYWSSL 93 >XP_010247124.1 PREDICTED: coiled-coil domain-containing protein SCD2-like, partial [Nelumbo nucifera] Length = 344 Score = 67.8 bits (164), Expect = 6e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYW LCV+HG+HAEIA ++HEYWSSL Sbjct: 111 VVLKRCWLARYWNLCVRHGIHAEIAGAKHEYWSSL 145 >XP_010097351.1 hypothetical protein L484_010229 [Morus notabilis] EXB67661.1 hypothetical protein L484_010229 [Morus notabilis] Length = 729 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYW LCV+HG+HAEIA++R+EYWSSL Sbjct: 498 VVLKRCWLARYWSLCVEHGIHAEIAKARYEYWSSL 532 >XP_020113658.1 coiled-coil domain-containing protein SCD2-like isoform X2 [Ananas comosus] Length = 556 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYWKLCV HG+HA+IAE +H YWSSL Sbjct: 328 VVLKRCWLARYWKLCVNHGIHADIAEVKHAYWSSL 362 >XP_020113657.1 coiled-coil domain-containing protein SCD2-like isoform X1 [Ananas comosus] Length = 560 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYWKLCV HG+HA+IAE +H YWSSL Sbjct: 332 VVLKRCWLARYWKLCVNHGIHADIAEVKHAYWSSL 366 >KCW61705.1 hypothetical protein EUGRSUZ_H04425 [Eucalyptus grandis] Length = 233 Score = 65.9 bits (159), Expect = 1e-09 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYW LC+++G+HAEIAE++HE+WSSL Sbjct: 4 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHWSSL 38 >XP_019197643.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X7 [Ipomoea nil] Length = 498 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 276 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 309 >XP_010904828.1 PREDICTED: coiled-coil domain-containing protein SCD2-like [Elaeis guineensis] Length = 510 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYWKLCV +G+HA++AE++HE+WSSL Sbjct: 284 VVLKRCWLARYWKLCVNYGIHADVAETKHEHWSSL 318 >XP_019197642.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X6 [Ipomoea nil] Length = 600 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 378 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 411 >XP_019197641.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X5 [Ipomoea nil] Length = 615 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 393 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 426 >XP_019197640.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X4 [Ipomoea nil] Length = 622 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 436 >XP_019197639.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X3 [Ipomoea nil] Length = 623 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 436 >XP_019197638.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X2 [Ipomoea nil] Length = 624 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 436 >XP_019197637.1 PREDICTED: coiled-coil domain-containing protein SCD2-like isoform X1 [Ipomoea nil] Length = 625 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCV+HG+HA+IAE +HEYWSS Sbjct: 403 VVLKRCWLARYWGLCVEHGIHADIAEIKHEYWSS 436 >XP_010025105.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X3 [Eucalyptus grandis] Length = 673 Score = 65.9 bits (159), Expect = 4e-09 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYW LC+++G+HAEIAE++HE+WSSL Sbjct: 444 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHWSSL 478 >XP_010025106.2 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X2 [Eucalyptus grandis] Length = 677 Score = 65.9 bits (159), Expect = 4e-09 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYW LC+++G+HAEIAE++HE+WSSL Sbjct: 448 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHWSSL 482 >XP_018716822.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X1 [Eucalyptus grandis] Length = 678 Score = 65.9 bits (159), Expect = 4e-09 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSSL 107 VVLKRC LARYW LC+++G+HAEIAE++HE+WSSL Sbjct: 449 VVLKRCWLARYWSLCIKYGIHAEIAEAKHEHWSSL 483 >XP_012089161.1 PREDICTED: coiled-coil domain-containing protein SCD2-like [Jatropha curcas] Length = 653 Score = 65.5 bits (158), Expect = 6e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCVQHG+HAEIA +++EYWSS Sbjct: 430 VVLKRCWLARYWSLCVQHGIHAEIAGAKYEYWSS 463 >KDP23593.1 hypothetical protein JCGZ_23426 [Jatropha curcas] Length = 787 Score = 65.5 bits (158), Expect = 6e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 VVLKRCCLARYWKLCVQHGVHAEIAESRHEYWSS 104 VVLKRC LARYW LCVQHG+HAEIA +++EYWSS Sbjct: 427 VVLKRCWLARYWSLCVQHGIHAEIAGAKYEYWSS 460