BLASTX nr result
ID: Papaver32_contig00011224
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00011224 (1200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV35978.1 hypothetical protein F511_16960 [Dorcoceras hygrometr... 70 2e-11 KDO87023.1 hypothetical protein CISIN_1g0294372mg, partial [Citr... 70 2e-11 XP_010910670.1 PREDICTED: GTP-binding protein SAR1A-like [Elaeis... 70 2e-11 CBI22905.3 unnamed protein product, partial [Vitis vinifera] 70 2e-11 GAU48266.1 hypothetical protein TSUD_405120 [Trifolium subterran... 70 2e-11 XP_013670144.1 PREDICTED: GTP-binding protein SAR1B-like [Brassi... 70 2e-11 KDO81697.1 hypothetical protein CISIN_1g033893mg [Citrus sinensis] 70 4e-11 KYP32821.1 GTP-binding protein SAR1B [Cajanus cajan] 69 4e-11 XP_016695401.1 PREDICTED: uncharacterized protein LOC107911916 i... 70 5e-11 ONM31009.1 GTP-binding protein SAR1B [Zea mays] 69 6e-11 CAA69398.1 GTP-binding protein, partial [Nicotiana plumbaginifolia] 70 6e-11 CBI39581.3 unnamed protein product, partial [Vitis vinifera] 70 8e-11 AAA87886.1 NTGB2, partial [Nicotiana tabacum] 70 8e-11 XP_010096808.1 GTP-binding protein [Morus notabilis] EXB66049.1 ... 70 1e-10 AFK44533.1 unknown [Lotus japonicus] 70 1e-10 AAA87887.1 NTGB3, partial [Nicotiana tabacum] 69 1e-10 JAT67274.1 GTP-binding protein SAR1A, partial [Anthurium amnicola] 70 1e-10 XP_010531789.2 PREDICTED: GTP-binding protein SAR1B-like [Tarena... 70 1e-10 XP_006644142.1 PREDICTED: GTP-binding protein SAR1A-like [Oryza ... 70 1e-10 EAZ20864.1 hypothetical protein OsJ_36503 [Oryza sativa Japonica... 70 1e-10 >KZV35978.1 hypothetical protein F511_16960 [Dorcoceras hygrometricum] Length = 110 Score = 70.5 bits (171), Expect = 2e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAKKL 405 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK L Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVL 89 >KDO87023.1 hypothetical protein CISIN_1g0294372mg, partial [Citrus sinensis] Length = 87 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >XP_010910670.1 PREDICTED: GTP-binding protein SAR1A-like [Elaeis guineensis] Length = 88 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >CBI22905.3 unnamed protein product, partial [Vitis vinifera] Length = 114 Score = 70.5 bits (171), Expect = 2e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAKK 402 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK+ Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAKR 88 >GAU48266.1 hypothetical protein TSUD_405120 [Trifolium subterraneum] Length = 90 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >XP_013670144.1 PREDICTED: GTP-binding protein SAR1B-like [Brassica napus] Length = 92 Score = 69.7 bits (169), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >KDO81697.1 hypothetical protein CISIN_1g033893mg [Citrus sinensis] Length = 109 Score = 69.7 bits (169), Expect = 4e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >KYP32821.1 GTP-binding protein SAR1B [Cajanus cajan] Length = 99 Score = 69.3 bits (168), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQ+ARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQVARRVWKDYYAK 87 >XP_016695401.1 PREDICTED: uncharacterized protein LOC107911916 isoform X7 [Gossypium hirsutum] Length = 118 Score = 69.7 bits (169), Expect = 5e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 307 EELSIGKIKFKAFDLGGHQIARRVWKDYYAKKLQAGSI 420 EELSIG IKFKAFDLGGHQIARRVWKDYYAK +QA ++ Sbjct: 81 EELSIGMIKFKAFDLGGHQIARRVWKDYYAKVMQAMTV 118 >ONM31009.1 GTP-binding protein SAR1B [Zea mays] Length = 88 Score = 68.6 bits (166), Expect = 6e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIG+IKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGRIKFKAFDLGGHQIARRVWKDYYAK 87 >CAA69398.1 GTP-binding protein, partial [Nicotiana plumbaginifolia] Length = 126 Score = 69.7 bits (169), Expect = 6e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 37 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 68 >CBI39581.3 unnamed protein product, partial [Vitis vinifera] Length = 140 Score = 69.7 bits (169), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >AAA87886.1 NTGB2, partial [Nicotiana tabacum] Length = 140 Score = 69.7 bits (169), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 48 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 79 >XP_010096808.1 GTP-binding protein [Morus notabilis] EXB66049.1 GTP-binding protein [Morus notabilis] Length = 148 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 87 >AFK44533.1 unknown [Lotus japonicus] Length = 149 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 12 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 43 >AAA87887.1 NTGB3, partial [Nicotiana tabacum] Length = 111 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVW+DYYAK Sbjct: 56 SEELSIGKIKFKAFDLGGHQIARRVWRDYYAK 87 >JAT67274.1 GTP-binding protein SAR1A, partial [Anthurium amnicola] Length = 153 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 52 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 83 >XP_010531789.2 PREDICTED: GTP-binding protein SAR1B-like [Tarenaya hassleriana] Length = 155 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 18 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 49 >XP_006644142.1 PREDICTED: GTP-binding protein SAR1A-like [Oryza brachyantha] Length = 155 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 18 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 49 >EAZ20864.1 hypothetical protein OsJ_36503 [Oryza sativa Japonica Group] Length = 160 Score = 69.7 bits (169), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 304 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 399 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK Sbjct: 23 SEELSIGKIKFKAFDLGGHQIARRVWKDYYAK 54