BLASTX nr result
ID: Papaver32_contig00009483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00009483 (599 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006434875.1 hypothetical protein CICLE_v10000881mg [Citrus cl... 60 3e-07 XP_006434877.1 hypothetical protein CICLE_v10000881mg [Citrus cl... 60 3e-07 KDO84371.1 hypothetical protein CISIN_1g039936mg, partial [Citru... 60 3e-07 XP_006473400.1 PREDICTED: B3 domain-containing protein LOC_Os12g... 60 3e-07 XP_006434878.1 hypothetical protein CICLE_v10000881mg [Citrus cl... 60 3e-07 XP_006473396.1 PREDICTED: B3 domain-containing protein Os11g0197... 60 3e-07 XP_006434882.1 hypothetical protein CICLE_v10000881mg [Citrus cl... 60 3e-07 XP_010647802.1 PREDICTED: B3 domain-containing protein Os01g0723... 56 2e-06 XP_006833221.1 PREDICTED: B3 domain-containing protein LOC_Os12g... 57 3e-06 CAN82372.1 hypothetical protein VITISV_027623 [Vitis vinifera] 56 7e-06 CBI32502.3 unnamed protein product, partial [Vitis vinifera] 55 8e-06 GAV80341.1 B3 domain-containing protein [Cephalotus follicularis] 56 9e-06 >XP_006434875.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] XP_006434876.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48115.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48116.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] Length = 358 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 31 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 77 >XP_006434877.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48117.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] Length = 395 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 68 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 114 >KDO84371.1 hypothetical protein CISIN_1g039936mg, partial [Citrus sinensis] Length = 508 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 22 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 68 >XP_006473400.1 PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X2 [Citrus sinensis] Length = 517 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 31 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 77 >XP_006434878.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] XP_006434879.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] XP_006434880.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] XP_006434881.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48118.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48119.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48120.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48121.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] Length = 517 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 31 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 77 >XP_006473396.1 PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1 [Citrus sinensis] XP_006473397.1 PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1 [Citrus sinensis] XP_006473399.1 PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1 [Citrus sinensis] XP_015384334.1 PREDICTED: B3 domain-containing protein Os11g0197600-like isoform X1 [Citrus sinensis] Length = 554 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 68 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 114 >XP_006434882.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] XP_006434883.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48122.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] ESR48123.1 hypothetical protein CICLE_v10000881mg [Citrus clementina] Length = 554 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 33/47 (70%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 FF+KGW VF+R+N I D LVFRYDG + F+V++FD G +E F Sbjct: 68 FFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAF 114 >XP_010647802.1 PREDICTED: B3 domain-containing protein Os01g0723500-like [Vitis vinifera] XP_019073667.1 PREDICTED: B3 domain-containing protein Os01g0723500-like [Vitis vinifera] XP_019073669.1 PREDICTED: B3 domain-containing protein Os01g0723500-like [Vitis vinifera] Length = 179 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPR 470 + +KGW+ F++EN + +FL FRYDG+MQF VK+FD GV R Sbjct: 68 YLQKGWKQFMKENNLGDSEFLTFRYDGNMQFYVKIFDKSGVQR 110 >XP_006833221.1 PREDICTED: B3 domain-containing protein LOC_Os12g40080 [Amborella trichopoda] ERM98499.1 hypothetical protein AMTR_s00072p00182810 [Amborella trichopoda] Length = 499 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -2 Query: 595 FEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 F+ GW+ FVR+ + + DFLVFRYDG+MQF+V++FD G +E+ F Sbjct: 83 FDDGWKEFVRDCCLEMEDFLVFRYDGNMQFTVQIFDSTGCEKEDPF 128 >CAN82372.1 hypothetical protein VITISV_027623 [Vitis vinifera] Length = 492 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPR 470 + +KGW+ F++EN + +FL FRYDG+MQF VK+FD GV R Sbjct: 313 YLQKGWKQFMKENNLGDSEFLTFRYDGNMQFYVKIFDKSGVQR 355 >CBI32502.3 unnamed protein product, partial [Vitis vinifera] Length = 231 Score = 55.1 bits (131), Expect = 8e-06 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECFIPIHSSPLLEE 425 + E GW+ F+REN + +FLVF YDG M+F VK+F+ GV R PI +P EE Sbjct: 44 YLEDGWKEFMRENNLGDDEFLVFIYDGDMRFHVKIFEKNGVKRS---APISDNPTEEE 98 >GAV80341.1 B3 domain-containing protein [Cephalotus follicularis] Length = 551 Score = 55.8 bits (133), Expect = 9e-06 Identities = 23/47 (48%), Positives = 31/47 (65%) Frame = -2 Query: 598 FFEKGWEVFVRENGIHIYDFLVFRYDGSMQFSVKVFDMRGVPREECF 458 + +GW VFVR+N + D+LVFRYDG + FSV+VFD +E F Sbjct: 62 YLHRGWSVFVRDNCVESGDYLVFRYDGELHFSVQVFDQSACEKEAAF 108