BLASTX nr result
ID: Papaver32_contig00009102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00009102 (408 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018818478.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 65 3e-10 XP_018849381.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 64 1e-09 AFC88844.1 putative cysteine proteinase inhibitor, partial [Tetr... 61 1e-09 KZM82133.1 hypothetical protein DCAR_031840 [Daucus carota subsp... 62 3e-09 AAL79831.1 cystatin [Sandersonia aurantiaca] 60 4e-09 XP_017225530.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 62 5e-09 AAA96316.1 cysteine proteinase inhibitor [Brassica rapa subsp. o... 62 6e-09 KJB67860.1 hypothetical protein B456_010G215400 [Gossypium raimo... 62 8e-09 XP_013646830.1 PREDICTED: cysteine proteinase inhibitor 6-like [... 62 8e-09 AKB91191.1 cysteine-proteinase inhibitor 2 [Theobroma cacao] 59 1e-08 XP_010096012.1 Cysteine proteinase inhibitor 12 [Morus notabilis... 61 1e-08 XP_017183111.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 61 1e-08 XP_008354847.1 PREDICTED: cysteine proteinase inhibitor 12-like ... 61 2e-08 XP_008346634.1 PREDICTED: cysteine proteinase inhibitor 6 [Malus... 61 2e-08 AHZ92269.1 cystatin 3 [Malus prunifolia] 61 2e-08 AAO19652.1 cysteine protease inhibitor cystatin, partial [Malus ... 61 2e-08 XP_002267841.1 PREDICTED: cysteine proteinase inhibitor 12 [Viti... 60 2e-08 XP_018441087.1 PREDICTED: cysteine proteinase inhibitor 6 [Rapha... 60 3e-08 AJD79052.1 CPI-1 [Morus alba var. atropurpurea] 60 3e-08 XP_019107421.1 PREDICTED: cysteine proteinase inhibitor 6-like i... 59 5e-08 >XP_018818478.1 PREDICTED: cysteine proteinase inhibitor 6-like [Juglans regia] Length = 212 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPW+NFKELQEFKH+D S+S T SDLGVK+G Sbjct: 81 AKVWVKPWINFKELQEFKHADGAHSSSPFTSSDLGVKKG 119 >XP_018849381.1 PREDICTED: cysteine proteinase inhibitor 12-like [Juglans regia] Length = 243 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWMNFKELQEFKH+D S+S T SDLG K+G Sbjct: 112 AKVWVKPWMNFKELQEFKHADAGDSSSPFTTSDLGGKKG 150 >AFC88844.1 putative cysteine proteinase inhibitor, partial [Tetragonia tetragonioides] Length = 107 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKR 21 AKVWVKPWMNFKELQEFKH+D S TPSDLG KR Sbjct: 24 AKVWVKPWMNFKELQEFKHADDSPS---ITPSDLGAKR 58 >KZM82133.1 hypothetical protein DCAR_031840 [Daucus carota subsp. sativus] Length = 202 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRGD 15 AK+WVKPWMNFKELQEFKH + + TPSDLGVK+GD Sbjct: 74 AKIWVKPWMNFKELQEFKHVE---DCPSITPSDLGVKKGD 110 >AAL79831.1 cystatin [Sandersonia aurantiaca] Length = 110 Score = 60.1 bits (144), Expect = 4e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRGD 15 AKVWVKPW+NFKELQEF+H+ S TP+DLG KRGD Sbjct: 74 AKVWVKPWLNFKELQEFRHAGDSPSV---TPADLGAKRGD 110 >XP_017225530.1 PREDICTED: cysteine proteinase inhibitor 6-like [Daucus carota subsp. sativus] Length = 245 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRGD 15 AK+WVKPWMNFKELQEFKH + + TPSDLGVK+GD Sbjct: 117 AKIWVKPWMNFKELQEFKHVE---DCPSITPSDLGVKKGD 153 >AAA96316.1 cysteine proteinase inhibitor [Brassica rapa subsp. oleifera] Length = 205 Score = 61.6 bits (148), Expect = 6e-09 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFK-HSDHESSASTCTPSDLGVKRGD 15 AKVWVKPW+NFKELQEFK SD S ++T TPSDLG K+G+ Sbjct: 72 AKVWVKPWLNFKELQEFKPASDDGSPSATITPSDLGCKKGE 112 >KJB67860.1 hypothetical protein B456_010G215400 [Gossypium raimondii] Length = 231 Score = 61.6 bits (148), Expect = 8e-09 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWMN KELQEFKH+D S CT SDLG+K+G Sbjct: 111 AKVWVKPWMNVKELQEFKHADDSPS---CTTSDLGIKKG 146 >XP_013646830.1 PREDICTED: cysteine proteinase inhibitor 6-like [Brassica napus] Length = 235 Score = 61.6 bits (148), Expect = 8e-09 Identities = 29/41 (70%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFK-HSDHESSASTCTPSDLGVKRGD 15 AKVWVKPW+NFKELQEFK SD S ++T TPSDLG K+G+ Sbjct: 103 AKVWVKPWLNFKELQEFKPASDDGSPSATITPSDLGCKKGE 143 >AKB91191.1 cysteine-proteinase inhibitor 2 [Theobroma cacao] Length = 127 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKR 21 AKVWVKPWMNFKELQEFKH+ + + T SDLGVK+ Sbjct: 74 AKVWVKPWMNFKELQEFKHAGDADVSPSLTASDLGVKK 111 >XP_010096012.1 Cysteine proteinase inhibitor 12 [Morus notabilis] EXB62705.1 Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPW+NFKELQEFKH+ +A + T SDLGVK+G Sbjct: 108 AKVWVKPWLNFKELQEFKHTGDGDAAPSFTRSDLGVKQG 146 >XP_017183111.1 PREDICTED: cysteine proteinase inhibitor 12-like isoform X2 [Malus domestica] Length = 213 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWM FKE+QEFKH+D E + S T SDLGVK+G Sbjct: 114 AKVWVKPWMGFKEVQEFKHADEEETPSV-TSSDLGVKQG 151 >XP_008354847.1 PREDICTED: cysteine proteinase inhibitor 12-like isoform X1 [Malus domestica] Length = 244 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWM FKE+QEFKH+D E + S T SDLGVK+G Sbjct: 114 AKVWVKPWMGFKEVQEFKHADEEETPSV-TSSDLGVKQG 151 >XP_008346634.1 PREDICTED: cysteine proteinase inhibitor 6 [Malus domestica] Length = 245 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWM FKE+QEFKH+D E + S T SDLGVK+G Sbjct: 115 AKVWVKPWMGFKEVQEFKHADEEETPSV-TSSDLGVKQG 152 >AHZ92269.1 cystatin 3 [Malus prunifolia] Length = 245 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWM FKE+QEFKH+D E + S T SDLGVK+G Sbjct: 115 AKVWVKPWMGFKEVQEFKHADEEETPSV-TSSDLGVKQG 152 >AAO19652.1 cysteine protease inhibitor cystatin, partial [Malus domestica] Length = 246 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWM FKE+QEFKH+D E + S T SDLGVK+G Sbjct: 116 AKVWVKPWMGFKEVQEFKHADEEETPSV-TSSDLGVKQG 153 >XP_002267841.1 PREDICTED: cysteine proteinase inhibitor 12 [Vitis vinifera] Length = 201 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKR 21 AKVWVKPWMNFKELQEFKH+ T TPSDLGVK+ Sbjct: 73 AKVWVKPWMNFKELQEFKHA---GDVPTLTPSDLGVKK 107 >XP_018441087.1 PREDICTED: cysteine proteinase inhibitor 6 [Raphanus sativus] Length = 236 Score = 60.1 bits (144), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSAS---TCTPSDLGVKRGD 15 AKVWVKPW+NFKELQEFK + + AS T TPSDLG K+G+ Sbjct: 102 AKVWVKPWLNFKELQEFKPASDDGGASTTNTITPSDLGCKKGE 144 >AJD79052.1 CPI-1 [Morus alba var. atropurpurea] Length = 239 Score = 60.1 bits (144), Expect = 3e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPW+NFKELQEFKH+ +A + T SDLGVK G Sbjct: 108 AKVWVKPWLNFKELQEFKHTGDGDAAPSFTRSDLGVKLG 146 >XP_019107421.1 PREDICTED: cysteine proteinase inhibitor 6-like isoform X2 [Beta vulgaris subsp. vulgaris] Length = 212 Score = 59.3 bits (142), Expect = 5e-08 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -2 Query: 134 AKVWVKPWMNFKELQEFKHSDHESSASTCTPSDLGVKRG 18 AKVWVKPWMNFKELQEFKH+D S TPSDLG +G Sbjct: 118 AKVWVKPWMNFKELQEFKHADDSPS---ITPSDLGAIKG 153